Align NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized)
to candidate WP_049768148.1 MSIL_RS10650 ABC transporter ATP-binding protein
Query= TCDB::P73650 (240 letters) >NCBI__GCF_000021745.1:WP_049768148.1 Length = 249 Score = 186 bits (472), Expect = 4e-52 Identities = 111/234 (47%), Positives = 151/234 (64%), Gaps = 5/234 (2%) Query: 4 LLVVKDVFAGYVADVPILQGINFSIAPGELVTVIGPNGAGKSTLAKTIFGLLTPSQGEII 63 LL ++ V A Y A + L+G++ I GE+VT+IG NGAGK+TL TIFG GEI Sbjct: 14 LLSLRGVTAYYGAIIA-LRGVDLDIREGEIVTLIGANGAGKTTLMMTIFGNPRARDGEIR 72 Query: 64 FKGENITGLGSDQIVRRGMCYVPQVCNVFGSLTVAENLDMGAFLHQGP--TQTLKDRIYT 121 F GE+IT L + +I R G+ P+ +F ++V ENL MGA + G ++ L +RI+ Sbjct: 73 FAGEDITRLDTHKIARLGLAQSPEGRRIFPRMSVYENLQMGAGVDGGGHFSEDL-ERIFA 131 Query: 122 MFPKLAQRRNQRAGTLSGGERQMLAMGRALMLDPDLLLLDEPSAALSPILVKDVFAQIKA 181 +FP+L +R QR GTLSGGE+QMLA+ RALM P LLLLDEPS L+P++VK +F ++ Sbjct: 132 IFPRLKERAGQRGGTLSGGEQQMLAIARALMSRPRLLLLDEPSLGLAPLVVKQIFEVVRD 191 Query: 182 IN-ATGKAIILVEQNAKQALMMADRGYVLENGRDKLEGSGQSLLNDPLVGELYL 234 +N G + LVEQNA AL +ADR +V+ NG L G+G+ LL P V YL Sbjct: 192 LNRREGLTVFLVEQNAFHALSLADRAHVMVNGAITLSGAGRELLARPEVRAAYL 245 Lambda K H 0.320 0.139 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 173 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 240 Length of database: 249 Length adjustment: 24 Effective length of query: 216 Effective length of database: 225 Effective search space: 48600 Effective search space used: 48600 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory