Align ABC transporter ATP-binding protein (characterized, see rationale)
to candidate WP_012591092.1 MSIL_RS10645 ATP-binding cassette domain-containing protein
Query= uniprot:A0A165KC86 (260 letters) >NCBI__GCF_000021745.1:WP_012591092.1 Length = 306 Score = 188 bits (478), Expect = 1e-52 Identities = 121/296 (40%), Positives = 164/296 (55%), Gaps = 47/296 (15%) Query: 4 KSNEVVLKVAGISKRFGGLQALSDVGITIKRGQVYGLIGPNGAGKTTFFNVITGLYTPDA 63 + N +L V ++ RFGGL A+ + + + G++ LIGPNGAGKTT FN +TG Y A Sbjct: 3 RDNAPLLIVDQLTMRFGGLCAVDALDFSARGGEITALIGPNGAGKTTLFNCVTGFYRSCA 62 Query: 64 GTFELAGK-PYEPTAVHE-----------------------------------VAKAGIA 87 G LA P P A V +AG+A Sbjct: 63 GRIALARPDPDSPGAFRADWREELAELTRSTRRSARIKGGEIFLLERMADFEIVKRAGVA 122 Query: 88 RTFQNIRLFAEMTALENVMVGRHIRTGSGLFGAVFRTKG------FKAEEAAIAKRAQEL 141 RTFQNIRLF MT LEN++V +H R L G F G ++ E A + A+ Sbjct: 123 RTFQNIRLFRGMTVLENLIVAQHNR----LIGPAFDIAGRFGFGAYRGRERAALETARFW 178 Query: 142 LDYVGIGKFADYKARTLSYGDQRRLEIARALATDPQLIALDEPAAGMNATEKVQLRELID 201 LD VG+ AD A L YG QRRLEIARA+AT P L+ LDEPAAG+N E +L L+ Sbjct: 179 LDRVGLIARADEAAGDLPYGAQRRLEIARAMATAPTLLCLDEPAAGLNPRESHELTTLLL 238 Query: 202 RIRNDNR-TILLIEHDVKLVMGLCDRVTVLDYGKQIAEGNPAEVQKNEKVIEAYLG 256 +R+D+ +IL+IEHD+ +VM + D V VLD+G +IA+G +++++E VI+AYLG Sbjct: 239 SLRDDHDVSILIIEHDMSVVMAISDHVVVLDHGVKIADGTARDIREDEAVIKAYLG 294 Lambda K H 0.319 0.137 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 230 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 306 Length adjustment: 26 Effective length of query: 234 Effective length of database: 280 Effective search space: 65520 Effective search space used: 65520 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory