Align NatA aka BRAF aka SLR0467, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized)
to candidate WP_012589209.1 MSIL_RS00820 LPS export ABC transporter ATP-binding protein
Query= TCDB::Q55164 (267 letters) >NCBI__GCF_000021745.1:WP_012589209.1 Length = 321 Score = 135 bits (341), Expect = 8e-37 Identities = 85/249 (34%), Positives = 126/249 (50%), Gaps = 15/249 (6%) Query: 18 LLLAQGLSKSFGGLRAVDHADIVVKEGSITGLIGPNGAGKTTLFNLLSNFIRPDQGEVLF 77 +L L KS+ R ++ + V+ G GL+GPNGAGKTTLF ++S IRPD G + Sbjct: 84 VLSVMRLRKSYKMRRIIEDVSLTVRRGEAVGLLGPNGAGKTTLFYMISGLIRPDAGRIEL 143 Query: 78 NGDSIGQLAPHQIALRGSVRTFQVAKVLSRLTVLENMLLADQHQTGEKFLPRLINFRRVQ 137 +G + +L ++ A G Q + LTV +N+ + +K Q Sbjct: 144 DGHDVTRLPMYRRARLGIGYLPQEPSIFRGLTVEDNIRAVLEITQSDK-----------Q 192 Query: 138 KEERANREKAMAMLESVGLGAKAQDYAGALSGGQRKLLEMARALMSNPKLILLDEPAAGV 197 K ER + A+LE + A + + ALSGG+R+ E+ARAL P ILLDEP AG+ Sbjct: 193 KRER----ELDALLEEFDIAALRRSPSVALSGGERRRCEIARALACRPSFILLDEPFAGI 248 Query: 198 NPTLIGQICEHIVNWNRQGITFLVIEHNMDVIMTLCHHVWVLAEGRNLADGTPEQIQSDP 257 +P + I + + +GI LV +HN+ + L +++ GR L GTP I +D Sbjct: 249 DPIAVADIQTLVQHLKTRGIGVLVTDHNVRETLGLIDRAYIIHAGRVLTQGTPADIVADA 308 Query: 258 RVLEAYLGD 266 YLGD Sbjct: 309 EARRFYLGD 317 Lambda K H 0.319 0.136 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 203 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 321 Length adjustment: 26 Effective length of query: 241 Effective length of database: 295 Effective search space: 71095 Effective search space used: 71095 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory