Align NAD(P)+-dependent L-rhamnose 1-dehydrogenase (EC 1.1.1.378; EC 1.1.1.173) (characterized)
to candidate WP_015944814.1 DHAF_RS19070 3-oxoacyl-[acyl-carrier-protein] reductase
Query= metacyc::MONOMER-16230 (256 letters) >NCBI__GCF_000021925.1:WP_015944814.1 Length = 247 Score = 194 bits (494), Expect = 1e-54 Identities = 110/251 (43%), Positives = 158/251 (62%), Gaps = 6/251 (2%) Query: 1 MLLIDKTVIVTGASRGIGRAAARECARQGARVVIGHSGSDEGRAGALSLAEEIAAFGGTA 60 MLL + IVTG SRGIGRA A E AR GA+VV+ ++G E LSL +E GG A Sbjct: 1 MLLNNSVAIVTGGSRGIGRAIALELARAGAKVVVNYAGHGEKAEETLSLIQEA---GGEA 57 Query: 61 IAVGADAADLDSGEKLVAAAVEAFGSVDVLVNNAGICPFHSFLDMPRELYLKTVGTNLNG 120 +AV AD + ++ E+L+ ++ +G +D+LVNNAGI L M + + TNL G Sbjct: 58 LAVQADVSQVEDVERLIQTTLKTYGKIDILVNNAGITRDTLLLRMKETDWDAVLDTNLKG 117 Query: 121 AYFTVQAAARRMKEQGRGGAIIAVSSISALVGGAMQTHYTPTKAGLLSLMQSCAIALGPY 180 + +A ++ M +Q R G II +SS+ + G A Q +Y+ KAG++ +S A LG Sbjct: 118 VFLCTKAVSKSMMKQ-RSGVIINISSVVGITGNAGQANYSAAKAGIIGFTKSIAKELGSR 176 Query: 181 GIRCNAVLPGTIATDINKEDLSDLEKRERMTSRVPLGRLGEPDDLAGPIVFLASDMARYV 240 GIR NAV PG I+TD+ E L + E RE++ +++PLGR+G+P+D+A +VFLAS A Y+ Sbjct: 177 GIRVNAVAPGYISTDMT-ESLGE-EVREQVMTQIPLGRMGQPEDIARTVVFLASPAASYI 234 Query: 241 TGASLLVDGGL 251 TG +L VDGG+ Sbjct: 235 TGQTLAVDGGM 245 Lambda K H 0.319 0.136 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 158 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 256 Length of database: 247 Length adjustment: 24 Effective length of query: 232 Effective length of database: 223 Effective search space: 51736 Effective search space used: 51736 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory