GapMind for catabolism of small carbon sources

 

Protein WP_015930236.1 in Methylobacterium nodulans ORS 2060

Annotation: NCBI__GCF_000022085.1:WP_015930236.1

Length: 216 amino acids

Source: GCF_000022085.1 in NCBI

Candidate for 10 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
D-alanine catabolism Pf6N2E2_5404 lo ABC transporter for D-Alanine, permease component 1 (characterized) 31% 58% 122.9 BgtB aka GLNH aka SLL1270, component of Arginine/lysine/histidine/glutamine porter 42% 154.5
L-histidine catabolism aapM lo ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, permease component 2 (characterized) 31% 54% 118.6 BgtB aka GLNH aka SLL1270, component of Arginine/lysine/histidine/glutamine porter 42% 154.5
D-glucosamine (chitosamine) catabolism AO353_21720 lo ABC transporter for D-Glucosamine, permease component 1 (characterized) 32% 90% 116.3 BgtB aka GLNH aka SLL1270, component of Arginine/lysine/histidine/glutamine porter 42% 154.5
L-lysine catabolism hisM lo ABC transporter for L-Lysine, permease component 2 (characterized) 31% 89% 110.9 BgtB aka GLNH aka SLL1270, component of Arginine/lysine/histidine/glutamine porter 42% 154.5
L-arginine catabolism artM lo Histidine transport system permease protein HisM (characterized) 32% 87% 110.5 BgtB aka GLNH aka SLL1270, component of Arginine/lysine/histidine/glutamine porter 42% 154.5
L-histidine catabolism hisM lo Histidine transport system permease protein HisM (characterized) 32% 87% 110.5 BgtB aka GLNH aka SLL1270, component of Arginine/lysine/histidine/glutamine porter 42% 154.5
L-lysine catabolism hisQ lo ABC transporter for L-Lysine, permease component 1 (characterized) 34% 90% 110.2 BgtB aka GLNH aka SLL1270, component of Arginine/lysine/histidine/glutamine porter 42% 154.5
L-citrulline catabolism PS417_17595 lo ABC transporter permease subunit; SubName: Full=Amino acid ABC transporter permease; SubName: Full=Histidine transport system permease protein (characterized, see rationale) 34% 91% 102.8 BgtB aka GLNH aka SLL1270, component of Arginine/lysine/histidine/glutamine porter 42% 154.5
L-citrulline catabolism PS417_17600 lo ABC transporter permease; SubName: Full=Amino acid ABC transporter permease; SubName: Full=Histidine ABC transporter permease HisM; SubName: Full=Histidine transport system permease protein; SubName: Full=Histidine/lysine/arginine/ornithine ABC transporter permease HisM (characterized, see rationale) 31% 95% 102.1 BgtB aka GLNH aka SLL1270, component of Arginine/lysine/histidine/glutamine porter 42% 154.5
L-arginine catabolism artQ lo ABC transporter for L-Arginine, permease component 2 (characterized) 32% 94% 95.1 BgtB aka GLNH aka SLL1270, component of Arginine/lysine/histidine/glutamine porter 42% 154.5

Sequence Analysis Tools

View WP_015930236.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MRILSEGDILFILAAVRWTLLLSVIAFLGGAVGGLGVALARTGEIRPLRFAAMAYIKLFQ
GTPLLMQLFLAYFVPGIFGLSIDPWGAAALGLSLHASAFLGEIWRGSIETVPRGQWEAAT
ALGLRYWPRMALVIVPQAVRIAVPPTIGFLVQLIKGTSLASIIGFVELTRAAQIINNATF
RPFTLFGLVALVYFVICWPLSAYSRRIEKTFAVASR

This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory