Align 3-oxoadipyl-CoA thiolase; EC 2.3.1.174 (characterized, see rationale)
to candidate WP_043749977.1 MNOD_RS35365 acetyl-CoA C-acetyltransferase
Query= uniprot:D8ITH5 (401 letters) >NCBI__GCF_000022085.1:WP_043749977.1 Length = 394 Score = 305 bits (782), Expect = 1e-87 Identities = 176/398 (44%), Positives = 246/398 (61%), Gaps = 11/398 (2%) Query: 2 EALICDAIRTPFGRYGGALGAVRADDLAAAPIRSLMERNPGVDWSRVEDILYGCANQAGE 61 + ++C +RT G Y G+L + A DL A +R + R G+D + V ++ G QAG Sbjct: 5 DIVLCQPVRTAIGAYNGSLKGIPATDLGAVVVRETLRR-AGLDPAEVGSVVMGNVVQAG- 62 Query: 62 DNRNVARMAGLLAGLPIAVPGSTVNRLCGSSLDAVGMAARAIKSGEVQLMIAGGVESMTR 121 + N AR A + G P++VP TVNR+CGS A+ AA+ I SGEV++ +AGG+E+M R Sbjct: 63 NRMNPARQAAIGGGAPVSVPALTVNRVCGSGAQAIVTAAQQIVSGEVEIAVAGGMENMDR 122 Query: 122 APFVMGKAESAFARSAA-IFDTTIGWRFVNPLMKAQYGIDSMPETAENVATDFQINRADQ 180 AP+++ + A I D+ + + L A G S T +++A Q+ R Q Sbjct: 123 APYLLEGGRWGYRMGPAQILDSML----TDGLNDAFSGEHSGWHT-DDLAARCQLTREAQ 177 Query: 181 DAFALRSQQRWAAAQAAGFFAGEIAPLTIPQKKGDPLVVTTDEHPRPDTTLATLAKLKGV 240 D FA RSQQR+AAAQAAG F EI P+ I +KG P TDE PRPDTT+ LA+LK Sbjct: 178 DRFAARSQQRFAAAQAAGAFEAEIVPVEIKGRKG-PETFATDEAPRPDTTMEILARLKPA 236 Query: 241 VRPDGTVTAGNASGVNDGACALLLASPKAADLYRLKPRARVLGMATAGVAPRIMGFGPAP 300 R DGT+TAGNA G+N GA A+++A+ A+ + P R++ A V P + G GP P Sbjct: 237 FRKDGTITAGNAPGLNSGAAAMIVAARGTAEARGIAPLGRLVAYGIAAVEPGLFGLGPVP 296 Query: 301 AVRKVLAQVGLTLAQMDVIELNEAFAAQGLAVMRDLGLPDDAAHVNPNGGAIAIGHPLGA 360 A+R+ + + G TLAQ++ IE+NEAFAA LAV ++LGLP+D +N GGAIA GHP+GA Sbjct: 297 AIRRAMERAGWTLAQVERIEINEAFAAVPLAVAQELGLPEDI--INVEGGAIAHGHPIGA 354 Query: 361 SGARLVTTAINQLERSGGRYALCTMCIGVGQGIALVIE 398 +GA L T ++ + R G R + T+CIG GQGIAL +E Sbjct: 355 TGAVLTTRLLHSMRRDGLRRGVVTLCIGGGQGIALALE 392 Lambda K H 0.320 0.135 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 464 Number of extensions: 20 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 401 Length of database: 394 Length adjustment: 31 Effective length of query: 370 Effective length of database: 363 Effective search space: 134310 Effective search space used: 134310 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory