Align L-proline and D-alanine ABC transporter, permease component 1 (characterized)
to candidate WP_015928429.1 MNOD_RS08415 branched-chain amino acid ABC transporter permease
Query= reanno::azobra:AZOBR_RS08235 (301 letters) >NCBI__GCF_000022085.1:WP_015928429.1 Length = 306 Score = 392 bits (1008), Expect = e-114 Identities = 198/306 (64%), Positives = 251/306 (82%), Gaps = 5/306 (1%) Query: 1 MEYFLQQLINGLSLGAIYGLIAIGYTMVYGIIGMINFAHGEIYMIGAFVALITFLAIGS- 59 ME F QQLINGL+LG+IYGLIAIGYTMV+GIIGMINFAHG+++M+ AF+ALI FL + + Sbjct: 1 MEVFAQQLINGLTLGSIYGLIAIGYTMVFGIIGMINFAHGDVFMLSAFIALIVFLILTTV 60 Query: 60 LGITWVPLALLVMLVASMLFTAVYGWTVERIAYRPLRSSPRLAPLISAIGMSIFLQNYVQ 119 LGI V LAL+++++ +M TA++GW++ERIAYRPLR S RLAPLISAIG+SIFL N+VQ Sbjct: 61 LGIGSVVLALILVMIVAMALTALWGWSIERIAYRPLRGSFRLAPLISAIGVSIFLSNFVQ 120 Query: 120 ILQGARSKPLQPILPGNLTLMDG----AVSVSYVRLATIVITIALMYGFTQLITRTSLGR 175 ++QGAR+KP P++ + L G AV++SY ++ +++T ++ GF L+ TSLGR Sbjct: 121 VVQGARNKPTPPMMRDVIVLWTGENGYAVALSYKQIIIMLVTGVMLLGFWYLVQHTSLGR 180 Query: 176 AQRACEQDKKMAGLLGVNVDRVISLTFVMGAALAAVAGMMVLLIYGVIDFYIGFLAGVKA 235 AQRACEQD+KMA LLG++VDR ISLTFV+GAALAAVAG M LL YGV+ F GF+ GVKA Sbjct: 181 AQRACEQDRKMAALLGIDVDRTISLTFVLGAALAAVAGTMYLLYYGVVSFSDGFVPGVKA 240 Query: 236 FTAAVLGGIGSLPGAMLGGVVIGLIEAFWSGYMGSEWKDVATFTILVLVLIFRPTGLLGR 295 FTAAVLGGIGSLPGA+LGG++IGLIE FWS Y E+KDVA F+IL +VLIF P+G+LGR Sbjct: 241 FTAAVLGGIGSLPGAVLGGLIIGLIETFWSAYFSIEYKDVAAFSILAIVLIFMPSGILGR 300 Query: 296 PEIEKV 301 PE+EKV Sbjct: 301 PEVEKV 306 Lambda K H 0.329 0.144 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 420 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 301 Length of database: 306 Length adjustment: 27 Effective length of query: 274 Effective length of database: 279 Effective search space: 76446 Effective search space used: 76446 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory