Align L-arabinose ABC transporter, permease protein AraH (characterized)
to candidate WP_012631047.1 MNOD_RS38655 ABC transporter permease
Query= CharProtDB::CH_014278 (328 letters) >NCBI__GCF_000022085.1:WP_012631047.1 Length = 344 Score = 169 bits (429), Expect = 7e-47 Identities = 101/284 (35%), Positives = 159/284 (55%), Gaps = 21/284 (7%) Query: 56 LAISMSGMVACGMLFCLASGDFDLSVASVIACAGVTTAVVINLTESLW------------ 103 L +S+ G++A G+ + +G DLS SV+ + + A + S W Sbjct: 64 LQVSVIGIIAIGVTQVIITGGIDLSSGSVVGLSAMVAAS--DAQSSAWTKVLYPSMTDLP 121 Query: 104 --IGVAAGLLLGVLCGLVNGFVIAKLKINALITTLATMQIVRGLAYIISDGKAVGIEDES 161 + + GL +G+L G++NG +I KI I TL M RGL+ + G+ V + Sbjct: 122 VAVPILVGLAIGLLAGVINGMLIVYTKIPPFIATLGMMVSARGLSKWYTKGQPVSGLTDE 181 Query: 162 FFALGYANWFGLPAPIWLTVACLIIFGLLLNKTTFGRNTLAIGGNEEAARLAGVPVVRTK 221 F +G W P I+L+VA +IF +LL T +G+ T AIG NE+AAR++G+ V R Sbjct: 182 FSVIGSGIW---PVVIFLSVA--VIFHVLLRYTRYGKFTYAIGANEQAARISGIEVDRHL 236 Query: 222 IIIFVLSGLVSAIAGIILASRMTSGQPMTSIGYELIVISACVLGGVSLKGGIGKISYVVA 281 I ++ ++GL+ +AGI+ A+R + Q YEL I+A V+GG SL GG+G+I+ V Sbjct: 237 IKVYGVAGLLGGLAGIVTAARAQTAQAGMGTMYELDAIAAAVIGGASLSGGVGRITGTVI 296 Query: 282 GILILGTVENAMNLLNISPFAQYVVRGLILLAAVIFDRYKQKAK 325 G +ILGT+ + L + F Q +++GLI++AAV D Y+QK + Sbjct: 297 GTIILGTMTSGFTFLRVDAFYQEIIKGLIIIAAVAADVYRQKKR 340 Lambda K H 0.327 0.141 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 362 Number of extensions: 20 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 328 Length of database: 344 Length adjustment: 28 Effective length of query: 300 Effective length of database: 316 Effective search space: 94800 Effective search space used: 94800 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory