Align Acetyl-CoA acetyltransferase; Acetoacetyl-CoA thiolase; Beta-ketothiolase; EC 2.3.1.9 (characterized)
to candidate WP_015929439.1 MNOD_RS13390 3-oxoadipyl-CoA thiolase
Query= SwissProt::P45363 (394 letters) >NCBI__GCF_000022085.1:WP_015929439.1 Length = 404 Score = 315 bits (806), Expect = 2e-90 Identities = 180/398 (45%), Positives = 246/398 (61%), Gaps = 9/398 (2%) Query: 5 IVIVDAGRTAIGTFGGALSALQATDIGTTVLKALIERTGIAPEQVSEVILGQVLTAG-CG 63 + I D RT IG +GGAL++++A D+ L AL+ R + V EV LG AG Sbjct: 7 VYICDFVRTPIGRYGGALASVRADDLAAIPLAALLHRNPSLKDGVEEVFLGCANQAGEDN 66 Query: 64 QNPARQTTLMAGLPHTVPAMTINKVCGSGLKAVHLAMQAVACGDAEIVIAGGQESMSQSS 123 +N AR L+AGLP TVP +T+N++C SGL AV A +A+ GD ++ +AGG ESM+++ Sbjct: 67 RNVARMALLLAGLPETVPGLTLNRLCASGLDAVGAAARAIRSGDIDLALAGGVESMTRAP 126 Query: 124 HVLPRSREGQRMGDWPMKDTMIVDGLWDAFNQCHMGV-----TAENIAKKYAFTREAQDA 178 V+ +S EG + DT I + + GV TAEN+A+ + +R QDA Sbjct: 127 FVMGKS-EGAWQRQAEIHDTTIGWRFINPMLKHQYGVDSMPETAENVAEDFQISRADQDA 185 Query: 179 FAAASQQKAEAAIQSGRFADEIIPVSIPQRKGDPLVFDTDEFPRPGTTAETLGRLRPAFD 238 FA SQ++A A G A EI V+IP R+GD D DE PRP TTAE L +L+P Sbjct: 186 FALRSQERAARAQADGILAQEITAVAIPTRQGDHRRVDRDEHPRPETTAEGLAKLKPFVR 245 Query: 239 KQGTVTAGNASGINDGAAMVVVMKESKAKELGLTPMARLVAFSSAGVDPAIMGTGPIPAS 298 + GTVTAGNASG+NDGAA +V+ A GLTP+ R++ +SAGV P +MG GP+PA Sbjct: 246 RDGTVTAGNASGVNDGAAALVLASAEAAARHGLTPLTRVLGLASAGVPPRVMGIGPVPAV 305 Query: 299 TDCLKKAGWAPADLDLVEANEAFAAQAMSVNQEMGW--DLSKVNVNGGAIAIGHPIGASG 356 T + G P+D D++E NEAFA+Q+++ + +G D VN +GGAIA GHP+G SG Sbjct: 306 TALCARLGLKPSDFDVIELNEAFASQSLACLRGLGLPDDAEHVNPHGGAIAFGHPLGMSG 365 Query: 357 ARVLVTLLYEMQKRDAKKGLATLCIGGGQGVALAVERL 394 AR+ E+ +R + GLATLC+G GQGVALAVER+ Sbjct: 366 ARIAGAATRELVRRGGRLGLATLCVGVGQGVALAVERV 403 Lambda K H 0.317 0.131 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 360 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 394 Length of database: 404 Length adjustment: 31 Effective length of query: 363 Effective length of database: 373 Effective search space: 135399 Effective search space used: 135399 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory