Align 5-aminovalerate transaminase (EC 2.6.1.48) (characterized)
to candidate WP_015929538.1 MNOD_RS13870 aspartate aminotransferase family protein
Query= BRENDA::Q9I6M4 (426 letters) >NCBI__GCF_000022085.1:WP_015929538.1 Length = 457 Score = 182 bits (461), Expect = 2e-50 Identities = 137/425 (32%), Positives = 207/425 (48%), Gaps = 41/425 (9%) Query: 23 IHPVVAER------------AENSTVWDVEGREYIDFAGGIAVLNTGHLHPKVIAAVQEQ 70 +HPV + R A+ +TV D GRE +D G+ +N G+ H ++ A Q Sbjct: 15 VHPVASYRGHERTGVRVLRSAKGATVTDAAGRELLDGFAGLWCVNAGYGHDSIVEAAARQ 74 Query: 71 LGKLSH-TCFQVLAYEPYIELAEEIAKRVPGDFPKKTLLVTSGSEAVENAVKIARAATGR 129 + +L + T + L EP I LA +A+R PGD GS+AV+ V++ R Sbjct: 75 MRELPYATAYFGLGSEPAIRLAAALAERAPGDL-NHVYFTLGGSDAVDTTVRLIRNYQTV 133 Query: 130 AG------VIAFTGAYHGRTMMTLGLTGKVVPYSAGMGLMPGGIFRALAPCELHGVSEDD 183 G I+ YHG + + GLT + + A GL + +P + D Sbjct: 134 RGKPEKDQFISLEQGYHGSSTVGAGLTA-LPAFHANFGLPFAWQHKIPSPYPYRNPAGSD 192 Query: 184 SIASIE------RIFKNDAQPQDIAAIIIEPVQGEGGFYVNSKSFMQRLRALCDQHGILL 237 A I R + P+ +AA EP+QG GG V + +M+ +R LC + IL Sbjct: 193 LEAIIAASLAALRAKVEELGPERVAAFYAEPIQGSGGVIVPPRGWMKAMRDLCAELDILF 252 Query: 238 IADEVQTGAGRTGTFFATEQLGIVPDLTTFAKSVGGGF-PISGVAGKAEIMDAIAPG--- 293 +ADEV TG GRTG FA + +VPDL T AK + G+ P+ V I D IA G Sbjct: 253 VADEVITGFGRTGPLFACTEDEVVPDLMTTAKGLTSGYVPMGAVFLSNRIYDTIADGAGE 312 Query: 294 ---GLGGTYAGSPIACAAALAVLKVFEEEKLLERSQAVGERLKAGLREIQAKHKVIGDVR 350 G G TY+ P++ A L VL+++ E LLE + G RL+AGL+ + A H ++GDVR Sbjct: 313 AAIGHGYTYSAHPVSAAVGLEVLRLY-ENGLLENGRRAGTRLQAGLQSL-ADHPLVGDVR 370 Query: 351 GLGSMVAIELFEGGDTHKP---AAELVSKIVVRAREKGLILLSCGTYYNVIRFLMPVTIP 407 G G + A+EL P AA+ +I RA GL++ + G ++ + P+ Sbjct: 371 GRGLLAALELVVDKARKAPLPAAADPARRIFDRAWNNGLVIRAFGN--GILGYAPPLCCT 428 Query: 408 DAQLE 412 +A+++ Sbjct: 429 EAEID 433 Lambda K H 0.319 0.137 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 423 Number of extensions: 22 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 426 Length of database: 457 Length adjustment: 32 Effective length of query: 394 Effective length of database: 425 Effective search space: 167450 Effective search space used: 167450 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory