Align Fructose import permease protein FruF (characterized)
to candidate WP_012631047.1 MNOD_RS38655 ABC transporter permease
Query= SwissProt::Q8G846 (356 letters) >NCBI__GCF_000022085.1:WP_012631047.1 Length = 344 Score = 122 bits (307), Expect = 1e-32 Identities = 86/259 (33%), Positives = 134/259 (51%), Gaps = 30/259 (11%) Query: 70 MIATGMTLVISTAGIDLSVGSVMAVAGAAAMQTLSNG------------MNVWLSILIAL 117 +IA G+T VI T GIDLS GSV+ ++ A + + V + IL+ L Sbjct: 71 IIAIGVTQVIITGGIDLSSGSVVGLSAMVAASDAQSSAWTKVLYPSMTDLPVAVPILVGL 130 Query: 118 AVGLAIGCVNGALVSFLGLQPFITTLIMMLAGRGMAKVITSGEN----TDASAVAGNEPL 173 A+GL G +NG L+ + + PFI TL MM++ RG++K T G+ TD +V G+ Sbjct: 131 AIGLLAGVINGMLIVYTKIPPFIATLGMMVSARGLSKWYTKGQPVSGLTDEFSVIGS--- 187 Query: 174 KWFANGFILGIPANFVIAVIIVILVGLLCRKTAMGMMIEAVGINQEASRMTGIKPKKILF 233 GI VI + + ++ +L R T G A+G N++A+R++GI+ + L Sbjct: 188 ---------GI-WPVVIFLSVAVIFHVLLRYTRYGKFTYAIGANEQAARISGIEVDRHLI 237 Query: 234 LVYAISGFLAAIAGLFATASVMRVDVVKTGQDLEMYAILAVVIGGTSLLGGKFSLAGSAV 293 VY ++G L +AG+ TA+ + G E+ AI A VIGG SL GG + G+ + Sbjct: 238 KVYGVAGLLGGLAGI-VTAARAQTAQAGMGTMYELDAIAAAVIGGASLSGGVGRITGTVI 296 Query: 294 GAVIIAMIRKTIITLGVNA 312 G +I+ + L V+A Sbjct: 297 GTIILGTMTSGFTFLRVDA 315 Lambda K H 0.325 0.136 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 315 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 356 Length of database: 344 Length adjustment: 29 Effective length of query: 327 Effective length of database: 315 Effective search space: 103005 Effective search space used: 103005 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory