Align ABC transporter for L-Histidine, permease component 1 (characterized)
to candidate WP_015929045.1 MNOD_RS11495 amino acid ABC transporter permease
Query= reanno::acidovorax_3H11:Ac3H11_2554 (222 letters) >NCBI__GCF_000022085.1:WP_015929045.1 Length = 217 Score = 154 bits (388), Expect = 2e-42 Identities = 83/203 (40%), Positives = 130/203 (64%), Gaps = 1/203 (0%) Query: 12 VPQLLAGALVTVEITAASLLLGCVMGLLVGIGRLNPKRRVVYALCTAYVAAIRGTPLLVQ 71 VP LL G +T+ IT SL++ +GL+ + R++ ++ L ++ IRG P++VQ Sbjct: 12 VPILLQGVQLTILITVGSLVVSTALGLVWAMMRVSGIP-LLSGLSATFINVIRGIPIIVQ 70 Query: 72 LFILFFGLPQFGILLPAFVCGVIGLGIYSGAYVSEVVRGAIQSIDKGQMEAARSIGMSSG 131 LF ++F LP FGI L A GV+GLG+ AY +E R AI++IDKGQ+EAA++IGM G Sbjct: 71 LFYIYFVLPDFGIALTAVQAGVLGLGLAYSAYQAENFRAAIEAIDKGQIEAAQTIGMGWG 130 Query: 132 LAMRTVVLPQAVVRMIPPLGNEFIALIKNSALVSLLTIHDLMHEGQKIISVSYRSLEVYL 191 L MR VVLPQA+ +PP GN I ++K+S+ S +T+ +L +G+ I S ++++ V+ Sbjct: 131 LTMRRVVLPQALRIALPPYGNVMIMMLKDSSQASTITVAELALQGKLIASATFKNTSVFT 190 Query: 192 AIAVVYFILTGATTLVLRRIELR 214 +A++Y L+ L++R E R Sbjct: 191 LVALMYLTLSLPLILIVRHFEKR 213 Lambda K H 0.328 0.143 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 132 Number of extensions: 3 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 222 Length of database: 217 Length adjustment: 22 Effective length of query: 200 Effective length of database: 195 Effective search space: 39000 Effective search space used: 39000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory