Align Polar amino acid ABC transporter, inner membrane subunit (characterized, see rationale)
to candidate WP_015930984.1 MNOD_RS21090 amino acid ABC transporter permease
Query= uniprot:B2TBJ8 (250 letters) >NCBI__GCF_000022085.1:WP_015930984.1 Length = 240 Score = 102 bits (255), Expect = 5e-27 Identities = 64/212 (30%), Positives = 115/212 (54%), Gaps = 3/212 (1%) Query: 15 LLAAVPTTLGLFFCSLILGGLLSLVIVTMRVSPHWLPNRFARAYILVFRGSPLLIQMFLV 74 LL+ + T+ C+ I+ + VI MR P+ F Y+ VFR PLL+QMFL Sbjct: 25 LLSGLVWTIVTALCAWIIAFAVGSVIGVMRTLPNRAAQAFGNGYVEVFRNIPLLVQMFLW 84 Query: 75 YYGMGQFGVIRESFLW--PVLREPYMCAVLSLALCTAGYTAEIIRGGLMAVPVGQIEAGY 132 ++ + + + ++ W + P+ AV+ L TA AE +R G+ ++P GQ AG Sbjct: 85 FFVLPEL-LPQDWGTWLKQLPDAPFYTAVVCLGFFTASRVAEQVRAGIQSLPRGQRMAGT 143 Query: 133 SIGLSGFALLRRVIGPIALRQCLPAYSTEAVLLVKSTALASLVTVWEVTGVAQQIIQQTY 192 ++GL+ R V+ P A R LP ++E + +K+T++A + + E+T A+ + + ++ Sbjct: 144 ALGLTTGQTYRYVLLPNAYRIILPPLTSEFLNNLKNTSVALTIGLLELTARARSMQEFSF 203 Query: 193 RTTEVFICAALIYLFLNFVIVRLLGMLETRLS 224 + E F A ++Y+ +N V+V G LE +++ Sbjct: 204 QVFEAFTAATILYIIINLVVVTAAGFLERKVA 235 Lambda K H 0.331 0.143 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 132 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 250 Length of database: 240 Length adjustment: 24 Effective length of query: 226 Effective length of database: 216 Effective search space: 48816 Effective search space used: 48816 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory