Align Transmembrane component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate WP_015932926.1 MNOD_RS31080 branched-chain amino acid ABC transporter permease
Query= uniprot:Q1MCU0 (300 letters) >NCBI__GCF_000022085.1:WP_015932926.1 Length = 291 Score = 164 bits (416), Expect = 2e-45 Identities = 96/300 (32%), Positives = 163/300 (54%), Gaps = 11/300 (3%) Query: 1 MEYFVQQLLNGLTLGSIYGLVAIGYTMVYGIIGMINFAHGDIFMLGGFAALIVFLVLTSI 60 M+ +Q L G+ +G++Y LVA+G+ +++ ++NFA G+ M+ F +V+ ++ Sbjct: 1 MDLVLQLLFTGIGIGAVYALVALGFVLIFRATNVVNFAQGEFSMVAAF-----LMVVFAV 55 Query: 61 FAGLPVAVLLLVMLVVAMLMTSLWNWTIERVAYRPLRGSFRLAPLITAIGMSITLSNFIQ 120 P + L+ + ++ +L+N + Y PLR L +I+ IG SI L+N Sbjct: 56 DLQWPYWLSFLLAIGGMAVLGALFNLGV----YYPLRHRTYLPVIISTIGASIFLANTTL 111 Query: 121 VTQGPRNKPIPPMVSSV-YQFGNISVSLKQIIIIVITAVLLTIFWYIVNRTALGRAQRAT 179 GP+ + + P+ + G + + + ++II +TA+L+ ++ T LG+ +AT Sbjct: 112 ALYGPQPQVLSPVFETQGILLGPVFLDSQYLLIIAVTALLVAFQYWFFEHTLLGKKLQAT 171 Query: 180 EQDRKMAALLGVNVDQTISITFVMGAALAAVAGTMYLMYYGVASFNDGFTPGVKAFTAAV 239 QD++MAALLG+ V I +TFV A L +AG + V S G T +KAF A + Sbjct: 172 SQDKEMAALLGIPVAGMIMLTFVYSAVLGGIAGILVAPVLFV-SIQMGATIALKAFAATI 230 Query: 240 LGGIGSLPGAVFGGLLIGLIESLWSAYFTIAYKDVATFAILAFVLIFKPTGILGRPEVEK 299 +GG G + GA+ GGL +G+IE+ +AY ++ YKD F +L L +P G+ G EK Sbjct: 231 IGGFGDVTGAIIGGLALGIIETFGAAYVSVPYKDAFAFIVLVAFLTLRPQGLFGERIAEK 290 Lambda K H 0.329 0.143 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 283 Number of extensions: 22 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 300 Length of database: 291 Length adjustment: 26 Effective length of query: 274 Effective length of database: 265 Effective search space: 72610 Effective search space used: 72610 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory