Align Aspartate aminotransferase; AAT; AspAT; Putative 2-aminoadipate transaminase; Transaminase A; EC 2.6.1.1; EC 2.6.1.39 (characterized)
to candidate WP_015927614.1 MNOD_RS04305 aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme
Query= SwissProt::P58350 (410 letters) >NCBI__GCF_000022085.1:WP_015927614.1 Length = 402 Score = 369 bits (948), Expect = e-107 Identities = 187/396 (47%), Positives = 260/396 (65%), Gaps = 7/396 (1%) Query: 15 ASRISSIGVSEILKIGARAAAMKREGKPVIILGAGEPDFDTPEHVKQAASDAIHRGETKY 74 A R +SI S + A ++ EG+ +I GE DFDTP H+ +AA A GET+Y Sbjct: 7 ARRPASIKPSPSIAARALVTQLRAEGREIIDFTLGESDFDTPPHIVEAAYQAARSGETRY 66 Query: 75 TALDGTPELKKAIREKFQRENGLAYELDEITVATGAKQILFNAMMASLDPGDEVIIPTPY 134 T+ +GT L+ AI KF RENG+ + ++ V GAKQ++ A A+LD GDEVI+PTPY Sbjct: 67 TSSNGTKALRAAIVGKFARENGIDFTEAQVVVGCGAKQLIHAAFAATLDEGDEVIVPTPY 126 Query: 135 WTSYSDIVHICEGKPVLIACDASSGFRLTAEKLEAAITPRTRWVLLNSPSNPSGAAYSAA 194 W SY D+ + G PV++ +GF+LT L +AITPR +W++LNSP+NPSGA Y+ Sbjct: 127 WVSYPDMAVVNGGVPVIVPVGEETGFKLTPALLGSAITPRAKWLVLNSPNNPSGAVYTPE 186 Query: 195 DYRPLLEVLLRHPHVWLLVDDMYEHIVYDGFRFVTPAQLEPGLKNRTLTVNGVSKAYAMT 254 + L VL +HP V L+ D++YEH VYDG ++ P L RTL +NGVSKAYAMT Sbjct: 187 EIASLAAVLEQHPQVMLMTDEIYEHFVYDGQTAAAFTRVAPQLAGRTLVINGVSKAYAMT 246 Query: 255 GWRIGYAGGPRELIKAMAVVQSQATSCPSSISQAASVAALNGPQDFLKERTESFQRRRDL 314 GWRIGYA GP +LI+ + ++ SQ+T+CPSS+SQAA+VAALNG Q F++E ++ RRD Sbjct: 247 GWRIGYAAGPLKLIETITLLLSQSTTCPSSVSQAAAVAALNGDQSFVREANAIYETRRDR 306 Query: 315 VVNGLNAIDGLDCRVPEGAFYTFSGCAGVLGKVTPSGKRIKTDTDFCAYLLEDAHVAVVP 374 +V L+AI G+ C P GAFY + +G+LGK T G + +D D +LL++A VAV+ Sbjct: 307 IVGLLDAIPGITCARPAGAFYVYPNVSGLLGKRTSDGTTLNSDLDVSLFLLQEAGVAVID 366 Query: 375 GSAFGLSPFFRISYATSE-------AELKEALERIA 403 GS++GLSP+ RIS+ATS A+ + A+E +A Sbjct: 367 GSSYGLSPYIRISFATSLDTIDAGCAQFRRAVESLA 402 Lambda K H 0.318 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 491 Number of extensions: 27 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 410 Length of database: 402 Length adjustment: 31 Effective length of query: 379 Effective length of database: 371 Effective search space: 140609 Effective search space used: 140609 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory