Align putrescine-2-oxoglutarate transaminase (EC 2.6.1.82) (characterized)
to candidate WP_015931116.1 MNOD_RS21735 aspartate aminotransferase family protein
Query= BRENDA::P42588 (459 letters) >NCBI__GCF_000022085.1:WP_015931116.1 Length = 443 Score = 182 bits (461), Expect = 3e-50 Identities = 117/347 (33%), Positives = 178/347 (51%), Gaps = 26/347 (7%) Query: 76 LVDTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPL-HSQELLDPLRAMLAKTLA 134 L D +G+ +ID GG + +GH +P V++A+ Q + H+ LA+ L Sbjct: 24 LFDQEGRAYIDASGGAAVSCLGHGHPDVIAALHAQADRLAYAHTSFFTSEPAEALAERLV 83 Query: 135 ALTPGKLKYSFFCNSGTESVEAALKLAKAYQ---SPRGKFTFIATSGAFHGKSLGALSAT 191 P L Y +F + G+E+VEAALK+A+ Y G+ +A ++HG +LGAL+A Sbjct: 84 TDAPADLDYVYFVSGGSEAVEAALKMARQYFVEIGQPGRSRIVARRQSYHGNTLGALAAG 143 Query: 192 AKSTFRKPFMPLL----------------PGFRHVPFGNIEAMRTALNECKKTGDD-VAA 234 R F PLL PG +G + A + ++ + G + V A Sbjct: 144 GNEWRRAQFRPLLIETHHIDPCYAYRYQRPGESEAEYG-LRAAQALEDKLLELGPETVMA 202 Query: 235 VILEPIQGE-GGVILPPPGYLTAVRKLCDEFGALMILDEVQTGMGRTGKMFACEHENVQP 293 + EP+ G G + GYL VR++CD +G L+ILDEV GMGRTG + ACE + V P Sbjct: 203 FVAEPVVGATAGAVPAATGYLRRVREICDRYGVLLILDEVMCGMGRTGTLHACEQDGVAP 262 Query: 294 DILCLAKALGGGVMPIGATIATEEVFSVLFDNP--FLHTTTFGGNPLACAAALATINVLL 351 D++ +AK LGGG PIGAT + ++ + F H T+ +P+ACAAALA V+ Sbjct: 263 DLMPVAKGLGGGYQPIGATFLSGRIYDAFANGSGLFQHGHTYICHPMACAAALAVQEVIA 322 Query: 352 EQNLPAQAEQKGDMLLDGFRQLAREYPDLVQEARGKGMLMAIEFVDN 398 +NL + G L + +P V + RG+G+ M +E V++ Sbjct: 323 RENLLDNVKAMGRHLRRRLTERFGNHPH-VGDIRGRGLFMGVELVED 368 Lambda K H 0.320 0.135 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 507 Number of extensions: 25 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 459 Length of database: 443 Length adjustment: 33 Effective length of query: 426 Effective length of database: 410 Effective search space: 174660 Effective search space used: 174660 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory