Align Rhizopine-binding protein (characterized, see rationale)
to candidate WP_012631044.1 MNOD_RS38640 substrate-binding domain-containing protein
Query= uniprot:A0A0N9WNI6 (308 letters) >NCBI__GCF_000022085.1:WP_012631044.1 Length = 307 Score = 254 bits (650), Expect = 1e-72 Identities = 145/303 (47%), Positives = 196/303 (64%), Gaps = 6/303 (1%) Query: 10 LALSLMLASGAALADLRIGVSMSQFDDTWLTYLRESMDKQAKSMPDGVKLQFEDARSDVV 69 LA +L + A A RIGVSM+ D+ +LT L M +A + GV+L EDA+ DV Sbjct: 6 LAAALTACALPAYAGGRIGVSMTSLDNPFLTILLNGMKGEA-ARTKGVELMLEDAQRDVS 64 Query: 70 KQLSQVESFISQKVDAIVVNPVDTAATRKITEAAVKAGIPLVYVNRRPDDLK--LPKGVI 127 +QLSQV++F++ +VDAIVVN VD +T IT AA AGIPLVYVN P +L +PKG Sbjct: 65 RQLSQVQNFVANRVDAIVVNAVDGDSTAAITRAAKAAGIPLVYVNHPPAELGRGMPKGTA 124 Query: 128 TVASNDLEAGQMQMQYLAEKMKGKGDIVILLGDLANNSTTNRTKGVKEVLAKYPG--IKI 185 V SN+L++G MQ + + + + GKG VIL+G L N+S RTK V +V + P I I Sbjct: 125 FVGSNELDSGTMQARAVCKMLAGKGRAVILMGPLENHSALVRTKDVVDVF-RTPDCPIHI 183 Query: 186 DQEQTGTWSRDKGMTLVNDWLTQGRKFDAIVSNNDEMAIGAAMALKQAGVEKGSVLIAGV 245 +QT W R + LV WLT G +FDA+++N+DEMAIGAA ALK AGV V+IAG+ Sbjct: 184 LDKQTANWMRVEAQDLVASWLTAGMRFDAVIANSDEMAIGAAQALKSAGVAMKDVVIAGI 243 Query: 246 DGTPDGLRAVKKGDLAVSVFQDANGQAVDSIDAAVKMAKNEPVEQAVWVPYRLITPENVD 305 D TPDGL A+ GDL V+VFQ+A Q ++ AV MA E E A+WVP+ L+T +N+ Sbjct: 244 DATPDGLAAMATGDLDVTVFQNATRQGEVAVQTAVAMAAGEKAEDAIWVPFELVTKDNLA 303 Query: 306 QFK 308 +++ Sbjct: 304 EYR 306 Lambda K H 0.315 0.130 0.360 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 249 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 308 Length of database: 307 Length adjustment: 27 Effective length of query: 281 Effective length of database: 280 Effective search space: 78680 Effective search space used: 78680 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.5 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory