Align Triosephosphate isomerase; TIM; TPI; Triose-phosphate isomerase; EC 5.3.1.1 (characterized)
to candidate WP_015932018.1 MNOD_RS26370 triose-phosphate isomerase
Query= SwissProt::Q8L1Z5 (254 letters) >NCBI__GCF_000022085.1:WP_015932018.1 Length = 253 Score = 266 bits (681), Expect = 2e-76 Identities = 136/246 (55%), Positives = 173/246 (70%) Query: 6 RPFIAGNWKMNGTGESLGELRAIAAGISSDLGRLFEALICVPATLLSRAFDILGGENILL 65 RP +AGNWKMNGT SL L A+ AG++ +L + L+C PATL+ G + + Sbjct: 7 RPLVAGNWKMNGTRASLPVLEAVIAGLTPELASRIDVLVCPPATLVGTFAAAAAGTPVRI 66 Query: 66 GGQNCHFDDYGPYTGDISAFMLKEAGASHVIIGHSERRTVYQESDAIVRAKVQAAWRAGL 125 GGQ+ H G +TG I+A ML + GA+H I+GHSERR E+DA V AK A RAGL Sbjct: 67 GGQDVHAAPSGAHTGCIAAEMLADLGATHTIVGHSERRADQHETDAQVCAKALGARRAGL 126 Query: 126 VALICVGETLEERKSNKVLDVLTRQLEGSLPDGATAENIIIAYEPVWAVGTGNTATSADV 185 VA+ICVGET EER++ + L V+ QL GSLPDGATA + +IAYEPVWA+GTG T T+ADV Sbjct: 127 VAIICVGETREEREAGRTLAVVRGQLAGSLPDGATAADTVIAYEPVWAIGTGLTPTAADV 186 Query: 186 AEVHAFIHHKMHSRFGDEGAKIRLLYGGSVKPSNAFELLSTAHVNGALIGGASLKAIDFL 245 AEVH I ++ +R G EG ++R+LYGGSVKPSNA EL++ +V+GAL+GGASLKA DFL Sbjct: 187 AEVHGLIRRELQARLGAEGDRVRILYGGSVKPSNAAELMAVPNVDGALVGGASLKAEDFL 246 Query: 246 TICDVY 251 I Y Sbjct: 247 GIAAAY 252 Lambda K H 0.320 0.137 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 231 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 253 Length adjustment: 24 Effective length of query: 230 Effective length of database: 229 Effective search space: 52670 Effective search space used: 52670 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
Align candidate WP_015932018.1 MNOD_RS26370 (triose-phosphate isomerase)
to HMM TIGR00419 (tpiA: triose-phosphate isomerase (EC 5.3.1.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00419.hmm # target sequence database: /tmp/gapView.1719394.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00419 [M=228] Accession: TIGR00419 Description: tim: triose-phosphate isomerase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-56 177.9 0.9 1.6e-56 177.7 0.9 1.0 1 NCBI__GCF_000022085.1:WP_015932018.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_000022085.1:WP_015932018.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 177.7 0.9 1.6e-56 1.6e-56 1 228 [] 9 243 .. 9 243 .. 0.90 Alignments for each domain: == domain 1 score: 177.7 bits; conditional E-value: 1.6e-56 TIGR00419 1 lviinfKlnesvgkv...elevaklaeevaseagvevavappfvdldvvkdeve.seiqvaAqnvdavksGaf 69 lv +n+K+n+++ + e ++a l+ e+as+ + v v pp + + + ++ + ++++ q+v+a sGa+ NCBI__GCF_000022085.1:WP_015932018.1 9 LVAGNWKMNGTRASLpvlEAVIAGLTPELASR--IDVLVCPPATLVGTFAAAAAgTPVRIGGQDVHAAPSGAH 79 799*******9987522267788888899987..56678899888888877777699**************** PP TIGR00419 70 tGeisAemlkdlGakgvligHsErRsllkeadeliekkvarlkelglksvvCvgetleereaartinnvatta 142 tG i Aeml+dlGa ++++gHsErR+ +e+d + +k ++ gl +++Cvget eerea+rt+ +v + NCBI__GCF_000022085.1:WP_015932018.1 80 TGCIAAEMLADLGATHTIVGHSERRADQHETDAQVCAKALGARRAGLVAIICVGETREEREAGRTLAVVRGQL 152 *********************************************************************9887 PP TIGR00419 143 aaaA.....lepdvvAvEPveliGtGkpvskAeaevveksvrdhlkkvskevaesvrvlyGasvtaaedaela 210 a + v+A+EPv++iGtG + + A+ +v++ +r l+ + vr+lyG+sv+ +++ael+ NCBI__GCF_000022085.1:WP_015932018.1 153 AGSLpdgatAADTVIAYEPVWAIGTGLTPTAADVAEVHGLIRRELQARLGAEGDRVRILYGGSVKPSNAAELM 225 6543444447889*****************************9998866666899****************** PP TIGR00419 211 aqldvdGvLlasavlkae 228 a ++vdG+L+++a+lkae NCBI__GCF_000022085.1:WP_015932018.1 226 AVPNVDGALVGGASLKAE 243 ****************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (228 nodes) Target sequences: 1 (253 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 18.88 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory