Align glutaryl-CoA dehydrogenase (EC 1.3.8.6) (characterized)
to candidate WP_015927965.1 MNOD_RS06130 acyl-CoA dehydrogenase
Query= metacyc::G1G01-166-MONOMER (393 letters) >NCBI__GCF_000022085.1:WP_015927965.1 Length = 413 Score = 549 bits (1415), Expect = e-161 Identities = 269/392 (68%), Positives = 317/392 (80%), Gaps = 2/392 (0%) Query: 4 KASFNWIDPLLLDQQLTEEERMVRDSAYQFAQDKLAPRVLEAFRHEQTDPAIFREMGEVG 63 + +F W DP LL+ QLT+EER++RD+A FA ++L P ++EA+ E+TD +F MGE+G Sbjct: 22 RGAFRWDDPFLLEDQLTDEERLIRDTARSFAVERLLPGIVEAYAEEKTDRNLFNAMGELG 81 Query: 64 LLGATIPEQYGGSGLNYVCYGLIAREVERIDSGYRSMMSVQSSLVMVPINEFGTEAQKQK 123 LLG T+PE+YG +G +YV YGL+AREVER+DSGYRSMMSVQSSLVM PI +G E Q++ Sbjct: 82 LLGVTLPEEYGCAGASYVAYGLVAREVERVDSGYRSMMSVQSSLVMYPIYAYGDETQRKT 141 Query: 124 YLPKLASGEWIGCFGLTEPNHGSDPGSMITRARKVDGGYRLTGSKMWITNSPIADVFVVW 183 YLP LASGE +GCFGLTEP+ GSDPG M TRA+K+DGGY L+G K WI+N+PIADVFVVW Sbjct: 142 YLPGLASGELVGCFGLTEPDAGSDPGGMKTRAKKIDGGYLLSGVKTWISNAPIADVFVVW 201 Query: 184 AKDDAGD--IRGFVLEKGWQGLSAPAIHGKVGLRASITGEIVMDNVFVPEENIFPDVRGL 241 AK A D IRGF+LEKG +GLSAP I GK+ LRAS+TGEIVMD V VPE + P+V GL Sbjct: 202 AKSAAHDNQIRGFILEKGMKGLSAPKIKGKLSLRASVTGEIVMDGVEVPESALLPNVSGL 261 Query: 242 KGPFTCLNSARYGISWGALGAAEACWHTARQYTLDRQQFGRPLAANQLIQKKLADMQTEI 301 KGPF CLN ARYGISWGA+GAAE CWH ARQYTLDR QFGRPLA QL+Q+KLADMQTEI Sbjct: 262 KGPFGCLNRARYGISWGAMGAAEDCWHRARQYTLDRTQFGRPLAQTQLVQRKLADMQTEI 321 Query: 302 TLALQGCLRLGRMKDEGTAAVEITSIMKRNSCGKALDIARMARDMLGGNGISDEFGVARH 361 L LQ LR+GR+ DEG A E+ SI+KRN+CGKAL IAR ARDM GGNGI E+ V RH Sbjct: 322 ALGLQASLRVGRLFDEGRVAPEMISIVKRNNCGKALAIAREARDMHGGNGIMGEYHVMRH 381 Query: 362 LVNLEVVNTYEGTHDVHALILGRAQTGIQAFY 393 NLE VNTYEGTHDVHALILGRAQTG+QAF+ Sbjct: 382 AQNLETVNTYEGTHDVHALILGRAQTGLQAFF 413 Lambda K H 0.320 0.137 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 523 Number of extensions: 18 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 413 Length adjustment: 31 Effective length of query: 362 Effective length of database: 382 Effective search space: 138284 Effective search space used: 138284 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory