Align Gamma aminobutyrate transaminase 3, chloroplastic; Gamma-aminobutyrate transaminase isozyme 3; LeGABA-TP3; SlGABA-T3; EC 2.6.1.96 (characterized)
to candidate WP_015931116.1 MNOD_RS21735 aspartate aminotransferase family protein
Query= SwissProt::Q84P52 (520 letters) >NCBI__GCF_000022085.1:WP_015931116.1 Length = 443 Score = 253 bits (646), Expect = 1e-71 Identities = 142/420 (33%), Positives = 229/420 (54%), Gaps = 15/420 (3%) Query: 92 GSYVYDVNGKKYLDALAGLWCTSLGGNEPRLVAAATKQLNELAFYHSFWNRSTKPSLDLA 151 G ++D G+ Y+DA G + LG P ++AA Q + LA+ H+ + S +P+ LA Sbjct: 21 GVELFDQEGRAYIDASGGAAVSCLGHGHPDVIAALHAQADRLAYAHTSFFTS-EPAEALA 79 Query: 152 KELLDLFTANKMAKAFFTNSGSEANDTQVKLVWYYNNALGRPDKKKFIARTKSYHGSTLI 211 + L+ A+ + +F + GSEA + +K+ Y +G+P + + +AR +SYHG+TL Sbjct: 80 ERLVTDAPAD-LDYVYFVSGGSEAVEAALKMARQYFVEIGQPGRSRIVARRQSYHGNTLG 138 Query: 212 SASLSGLPALHQQFDLPAPFVLHTDCPHFWRFHQPGETEEEFSTRLANNLENLILKEGPE 271 + + G QF H D + +R+ +PGE+E E+ R A LE+ +L+ GPE Sbjct: 139 ALAAGGNEWRRAQFRPLLIETHHIDPCYAYRYQRPGESEAEYGLRAAQALEDKLLELGPE 198 Query: 272 TIAAFIAEPVMGA-GGVIPPPATYFEKVQAILKKYDILFIADEVICGFGRLGTMFGCEKY 330 T+ AF+AEPV+GA G +P Y +V+ I +Y +L I DEV+CG GR GT+ CE+ Sbjct: 199 TVMAFVAEPVVGATAGAVPAATGYLRRVREICDRYGVLLILDEVMCGMGRTGTLHACEQD 258 Query: 331 NIKPDLVSVAKALSSGYMPIGAVLVSPEVSDVIYSQSNKLGTFSHGFTYSGHPVSCAVAL 390 + PDL+ VAK L GY PIGA +S + D +N G F HG TY HP++CA AL Sbjct: 259 GVAPDLMPVAKGLGGGYQPIGATFLSGRIYDAF---ANGSGLFQHGHTYICHPMACAAAL 315 Query: 391 ETLKIYKERNIIEQVNRISPKFQEGL-KAFSDSPIIGEIRGTGLLHGTEFTDNKSPNDPF 449 ++ N+++ V + + L + F + P +G+IRG GL G E +++ PF Sbjct: 316 AVQEVIARENLLDNVKAMGRHLRRRLTERFGNHPHVGDIRGRGLFMGVELVEDRGSKAPF 375 Query: 450 PPEWGIGAYFGARCEKHGVLV--------RVAGDNIMMSPPYILSLEEIDELIIKYGKAL 501 P + + G+ V V GD+++++PP+I+ +D ++ + G+AL Sbjct: 376 APALKLNGRVKREAMERGLAVYPAGGTIDGVHGDHVLLAPPFIIDAATVDTIVERLGEAL 435 Lambda K H 0.317 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 533 Number of extensions: 20 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 520 Length of database: 443 Length adjustment: 34 Effective length of query: 486 Effective length of database: 409 Effective search space: 198774 Effective search space used: 198774 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory