Align ABC transporter for Xylitol, permease component 2 (characterized)
to candidate WP_015928110.1 MNOD_RS06825 carbohydrate ABC transporter permease
Query= reanno::Dino:3607127 (272 letters) >NCBI__GCF_000022085.1:WP_015928110.1 Length = 292 Score = 158 bits (400), Expect = 1e-43 Identities = 93/276 (33%), Positives = 154/276 (55%), Gaps = 6/276 (2%) Query: 2 TSTRSLFSQIALLVLIITVCVFPFYWMVTTSLKT--QIVALEA-PPVWIFEPTLSNYREA 58 T R L + L +I+ V +FPFYWM TS+K Q++ +E P ++ PTL + + Sbjct: 17 TLPRRLVTVYLPLTIILVVLLFPFYWMALTSIKPDDQLIDMETYNPFFVVSPTLKHITKL 76 Query: 59 LFEDGVLRTLINSLIIAISTTFLALVLGVPAAFALARFEFRGKKDLWFWFITNRMISPIV 118 LFE L N+++++++ T L+L V AA+A+ R +RG + ++ P + Sbjct: 77 LFETQYPLWLWNTMLVSVAATVLSLFASVLAAYAIVRIRYRGAAAVGGAIFLAYLVPPSI 136 Query: 119 LALPFFLIARNLGLLDKHITLILIYLTFNLPIVIWIVTDQFRGIPYDLDEAARLEGASQF 178 L +P I + GL D + LIL+Y T +P W++ F+ IPY+L+E A ++GA ++ Sbjct: 137 LFIPLATIIQAYGLFDSPLALILVYPTILIPFSTWLLMGYFKTIPYELEECALIDGAGRW 196 Query: 179 TIMRKICLPLAMPGVAVSAIFSFIFSWNELMFGL-ILTRSEAKTAPAMAVS-FMEGYNLP 236 I+ +I LPLA+PG+ + IFS WNE ++ L L+ + KT P VS F++G Sbjct: 197 QILTRIILPLAVPGLISAGIFSLTLCWNEFIYALTFLSSTPNKTVPVAVVSEFVDGDIYR 256 Query: 237 YGKIMATSTLIVIPVLIFALIASKQLVRGLTMGAVK 272 +G +MA + + +P++I + V +T GAVK Sbjct: 257 WGSLMAGALVGSLPLVILYSFFVEHYVSAMT-GAVK 291 Lambda K H 0.331 0.143 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 236 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 292 Length adjustment: 26 Effective length of query: 246 Effective length of database: 266 Effective search space: 65436 Effective search space used: 65436 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory