Align 2,3-dehydroadipyl-CoA hydratase (EC 4.2.1.17) (characterized)
to candidate WP_012755571.1 RLEG_RS26045 crotonase/enoyl-CoA hydratase family protein
Query= metacyc::MONOMER-15953 (257 letters) >NCBI__GCF_000023185.1:WP_012755571.1 Length = 267 Score = 169 bits (429), Expect = 4e-47 Identities = 106/263 (40%), Positives = 149/263 (56%), Gaps = 8/263 (3%) Query: 1 MPHTLSVDAPEQGVRLITLQRPEALNALNTQLLDELAAELALAEQDAETRAVVLTGS-RK 59 M T+ +D+ + G+ +TL RPE LNALN L+D L A L E D R V+LTGS + Sbjct: 1 MADTVLIDSRD-GIATLTLNRPEKLNALNYALIDRLLAILDAIETDRSIRVVILTGSGER 59 Query: 60 AFAAGADIKEMAERDLVGILEDPR--VAHWQRIAA----FSKPLIAAVNGFCLGGGCELA 113 AF+AG DI E +E G R VA QR+ A + KP+IAAVNG GGGCE+ Sbjct: 60 AFSAGGDIYEFSESVAQGADVAMRDFVARGQRLTARLEAYHKPVIAAVNGLAFGGGCEIT 119 Query: 114 MHADILIAGEDARFGQPEINLGIMPGAGGTQRLLRAVGKSLAMQMVLSGQAIDARHAQRA 173 + IA E A F +PEINL + P GGTQRL R G+ A++++L+G A + A Sbjct: 120 EAVPLAIASERALFAKPEINLAMPPTFGGTQRLPRLAGRKRALELLLTGDAFSPQRALEL 179 Query: 174 GLVSEVTLPELTIERALAIARVIAQKAPLAVRLAKEALLKAEDTDLASGLRFERHAFTVL 233 GLV+++ + + A +AR I + +PLA A+ + + +A GL E F + Sbjct: 180 GLVNQLVPHDALMPAAHDLARRILRHSPLAAASILTAVTRGINQSIAEGLLIEGEQFARM 239 Query: 234 AGTADRAEGIRAFQEKRRPEFTG 256 A TAD EG+ A+ E+R+P + G Sbjct: 240 APTADLREGLDAWIERRKPNYPG 262 Lambda K H 0.320 0.134 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 206 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 257 Length of database: 267 Length adjustment: 25 Effective length of query: 232 Effective length of database: 242 Effective search space: 56144 Effective search space used: 56144 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory