Align ABC transporter for Glycerol, permease component 1 (characterized)
to candidate WP_012760399.1 RLEG_RS31305 sugar ABC transporter permease
Query= reanno::acidovorax_3H11:Ac3H11_793 (298 letters) >NCBI__GCF_000023185.1:WP_012760399.1 Length = 305 Score = 128 bits (322), Expect = 1e-34 Identities = 85/280 (30%), Positives = 139/280 (49%), Gaps = 6/280 (2%) Query: 13 WFLILPVIICVAFSAILPLMTVVNYSVQD--IISPERRVFVGTEWFAAVMRDEELHAALW 70 +FL+ P +I + P + SV++ + P +VG + + A+M D +L Sbjct: 24 YFLLFPSLILLLLVVAYPTLYGFVISVREMRLTRPALNGWVGAKHYVAMMSDRVFWISLK 83 Query: 71 RQLTFSLAVLAVEIPLGILLALSMPAQGWKSSAVLVVVALSLLIPWNVVGTIWQIYGRAD 130 + A +A+E+ LG + A+++ + V++ L +P V G +W + Sbjct: 84 NTAIWVAAAIAIEVTLGFIAAVALNRNVPGTKLFGVLIPLPYFLPNVVAGHMWALLLDPR 143 Query: 131 IGLMGRMLQEMGIEYSYTG---NATQAWLTVLLMDVWHWTPLVALLAFAGLRSIPDAYYQ 187 +G++ +L G+ +Y + A +L++ WH P ALL AGL+ IP+ Y+ Sbjct: 144 LGVINDLLVRSGVLSTYKAWFADPATALAATILVEAWHGFPFFALLFLAGLKGIPEDLYK 203 Query: 188 AARIDGASKFAVFRYIQLPKMRGVLMIAVLLRFMDSFMIYTEPFVLTGGGPGNATTFLSQ 247 AA +DGA F+ I +P +R V+ AV+LR + VLTGGGPGNAT LS Sbjct: 204 AAAVDGAGPVRQFKLITVPMLRTVITAAVILRVISLVNSPDLLLVLTGGGPGNATQVLSL 263 Query: 248 YLTTKAVGQFDLGPAAAFSLIYFFIILLLCFILYNWMQRV 287 Y A +F+ G A A S++ F+IL++ LY RV Sbjct: 264 YAFQTAYREFNFGYAGALSVV-MFVILMVFATLYIKFTRV 302 Lambda K H 0.328 0.140 0.439 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 196 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 298 Length of database: 305 Length adjustment: 27 Effective length of query: 271 Effective length of database: 278 Effective search space: 75338 Effective search space used: 75338 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory