Align Maltose-transporting ATPase (EC 3.6.3.19) (characterized)
to candidate WP_012759619.1 RLEG_RS21560 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= reanno::psRCH2:GFF857 (371 letters) >NCBI__GCF_000023185.1:WP_012759619.1 Length = 358 Score = 372 bits (955), Expect = e-108 Identities = 200/358 (55%), Positives = 254/358 (70%), Gaps = 7/358 (1%) Query: 3 SVTLRDICKSYDGTPITRHIDLDIEDGEFVVFVGPSGCGKSTLLRLIAGLEDITSGDLLI 62 SV L+ + K Y + IDL I+ GEFVVFVGPSGCGKSTLLR+IAGLE+IT G LL+ Sbjct: 4 SVVLQKVEKRYGSLDVIHGIDLTIDPGEFVVFVGPSGCGKSTLLRMIAGLEEITGGGLLL 63 Query: 63 DNQRVNDLPPKDRSVGMVFQSYALYPHMTVAENMAFGLKLASVDKREIKRRVEAVAEILQ 122 DN+R+N++ P R + MVFQSYALYPHM+V +N+AFGL+ A K +I+ +V+ AEILQ Sbjct: 64 DNERMNEVAPAKRGIAMVFQSYALYPHMSVYKNLAFGLETAGYKKADIQPKVKRAAEILQ 123 Query: 123 LDKLLERKPKDLSGGQRQRVAIGRTMVREPKVFLFDEPLSNLDAFLRVQMRIEIARLHQR 182 ++KLLERKPK LSGGQRQRVAIGR +VREP++FLFDEPLSNLDA LRVQMR+EI+RLH+ Sbjct: 124 IEKLLERKPKALSGGQRQRVAIGRAIVREPRIFLFDEPLSNLDAELRVQMRVEISRLHRS 183 Query: 183 IRSTMIYVTHDQVEAMTLADKIVVLNAGEIAQVGQPLHLYHYPKNRFVAGFLGSPQMNFV 242 + +TMIYVTHDQVEAMT+ADKIVVLN+G I QVG PL LY+ P NRFVAGF+GSP+MNF+ Sbjct: 184 LGNTMIYVTHDQVEAMTMADKIVVLNSGRIEQVGAPLDLYNNPANRFVAGFIGSPKMNFL 243 Query: 243 EVRAISASPETVTIELPSGYPLTLP--VDGSAVSPGDPLTLGIRPEHFVMPDEADFTFHG 300 + R I ET T G + LP + G A G+ +T GIRPEH + + A Sbjct: 244 KAR-IEQVGETETSIHVCGNSVRLPRRLKGGA---GEEVTFGIRPEHLSLAEGAIALSTV 299 Query: 301 QITVAERLGQYNLLYLTLERLQDVITLCVDGNLRVTEGETFAAGLKADKCHLFRENGE 358 + + E LG +LY T Q ++T+ +DG +V G A +CH+F G+ Sbjct: 300 NVDLVENLGGATMLYTTTPDNQ-LLTVALDGQQKVERGANVKASFDPARCHVFDAAGK 356 Lambda K H 0.322 0.139 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 390 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 371 Length of database: 358 Length adjustment: 29 Effective length of query: 342 Effective length of database: 329 Effective search space: 112518 Effective search space used: 112518 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory