Align ABC-type sugar transport system, permease component protein (characterized, see rationale)
to candidate WP_003562293.1 RLEG_RS23605 ABC transporter permease
Query= uniprot:D8IZC8 (344 letters) >NCBI__GCF_000023185.1:WP_003562293.1 Length = 354 Score = 232 bits (591), Expect = 1e-65 Identities = 129/342 (37%), Positives = 207/342 (60%), Gaps = 29/342 (8%) Query: 14 PPGARRSSSTTAQWLLHRLGMLPVLVVLYLLFYGLTLYLSGDGTSNFASAENTMNILRQV 73 P GA S+ T L + + V ++ + +F NF S N + + + V Sbjct: 11 PKGANGSALLTLMKLRTFIALFAV-IIFFAIF-----------APNFTSTANMILMSKHV 58 Query: 74 AINLVLAAGMTFVILTAGIDLSVGSVLAVSAVL-------GMQVSLGAAPGW----AIPM 122 A+N LA GMTFVI+T GIDLSVGS++ + ++ G+++ +G + + + Sbjct: 59 ALNAFLAMGMTFVIITGGIDLSVGSIVGLCGMVAGGLILYGIELPIGYTIFFNLFEIVLI 118 Query: 123 FIFSGLVMGMVNGAMVALLNINAFVVTLGTMTAFRGAAYLLADGTTVLN------NDIPS 176 + GL++G++NG ++ LN+ F+ TLGT+ RG A L +DG T N Sbjct: 119 TVSIGLLIGLINGLLITKLNVAPFIATLGTLYIARGLALLSSDGQTFPNLVGRPEYATTG 178 Query: 177 FEWIGNGDFLHVPWLIWVAVAVVLLSWVILRKTVLGMHIYAIGGNLQAARLTGIRVGLVL 236 F++ G G L +P IW+ + + LL+ + R T +G HI+A+GGN +AAR++GIRV +V Sbjct: 179 FDFFGAGRILGLPVSIWILIVLALLAAYVARSTPIGRHIFAVGGNERAARMSGIRVDVVK 238 Query: 237 LFVYSISGLFSGLAGAMSASRLYGANGNWGSGYELDAIAAVVLGGTSLMGGVGSIWGTVV 296 +FVY SGL + + G + +S L A+ G +EL+AIAA VLGGTS+ GG G+I GT++ Sbjct: 239 IFVYMFSGLCAAIVGVVISSELMAAHPATGESFELNAIAAAVLGGTSMSGGRGTIGGTII 298 Query: 297 GALIIGVMNNGLTILGLSSFWQYVAKGAVIVLAVILDKWRQK 338 GA +IG++++GL ++G+SSFWQ V KG VI++AV++D+ +++ Sbjct: 299 GAFVIGILSDGLVMMGVSSFWQMVIKGLVIIIAVVVDQAQRR 340 Lambda K H 0.324 0.138 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 341 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 344 Length of database: 354 Length adjustment: 29 Effective length of query: 315 Effective length of database: 325 Effective search space: 102375 Effective search space used: 102375 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory