Align PotG aka B0855, component of Putrescine porter (characterized)
to candidate WP_012758328.1 RLEG_RS14315 ABC transporter ATP-binding protein
Query= TCDB::P31134 (377 letters) >NCBI__GCF_000023185.1:WP_012758328.1 Length = 353 Score = 258 bits (659), Expect = 2e-73 Identities = 143/331 (43%), Positives = 209/331 (63%), Gaps = 8/331 (2%) Query: 20 LEIRNLTKSYDGQHAVDDVSLTIYKGEIFALLGASGCGKSTLLRMLAGFEQPSAGQIMLD 79 L + N+ KS+ V + ++ I KGE + LG SGCGK+T+LRM+AGFE P+ G + ++ Sbjct: 4 LTLNNIQKSFGPVQVVKNFNMNIEKGEFVSFLGPSGCGKTTVLRMIAGFETPTGGTLTIN 63 Query: 80 GVDLSQVPPYLRPINMMFQSYALFPHMTVEQNIAFGLKQDKLPKAEIASRVNEMLGLVHM 139 G D S + P R I M+FQ+YALFP+MTV N+AFGLK K EI +RV EMLGL+ + Sbjct: 64 GKDQSALKPNQRNIGMVFQAYALFPNMTVHDNVAFGLKVAGAQKPEIDARVKEMLGLIKL 123 Query: 140 QEFAKRKPHQLSGGQRQRVALARSLAKRPKLLLLDEPMGALDKKLRDRMQLEVVDILERV 199 A R P+QLSGGQ+QRVALAR+LA +P++LLLDEP+ ALD K+R ++ E+ I +++ Sbjct: 124 DHLADRFPYQLSGGQQQRVALARALAVKPQVLLLDEPLSALDAKIRVSLREEIRQIQQQL 183 Query: 200 GVTCVMVTHDQEEAMTMAGRIAIMNRGKFVQIGEPEEIYEHPTTRYSAEFIGSVNVFEGV 259 G+T V VTHDQEEA++++ RI +MN GK QIG P EIY P TR+ A F+G++N+ E Sbjct: 184 GITTVFVTHDQEEALSISDRIVVMNAGKADQIGSPFEIYNTPATRFVASFVGTLNLIEAK 243 Query: 260 LKERQEDGLVLDSPGLVHPLKVDADASVVDNVPVHVALRPEKIMLCEEPPANGCNFAVGE 319 + + + + + G+ V A + + +ALRPE L + ++ G+ Sbjct: 244 VVDPDTNRIQIGDQGITLKQSVAAHKA---GETISLALRPEAGSLSDSVKSD--TALTGQ 298 Query: 320 VIHIAYLGDLSVYHVRLK-SGQMISAQLQNA 349 V+ +LG SV R+ G +IS + N+ Sbjct: 299 VVSAHFLG--SVIRTRMNVGGNVISFDMFNS 327 Lambda K H 0.321 0.137 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 298 Number of extensions: 11 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 353 Length adjustment: 30 Effective length of query: 347 Effective length of database: 323 Effective search space: 112081 Effective search space used: 112081 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory