Align 2-dehydro-3-deoxy-L-rhamnonate dehydrogenase (NAD(+)); 2-keto-3-deoxy-L-rhamnonate dehydrogenase; KDRDH; L-KDR dehydrogenase; EC 1.1.1.401 (characterized)
to candidate WP_012756018.1 RLEG_RS01525 zinc-dependent alcohol dehydrogenase family protein
Query= SwissProt::P0DOW0 (331 letters) >NCBI__GCF_000023185.1:WP_012756018.1 Length = 336 Score = 149 bits (375), Expect = 1e-40 Identities = 89/253 (35%), Positives = 131/253 (51%), Gaps = 8/253 (3%) Query: 11 TMSILSAPAPVPEPGWIALRVAGVGICGSELSGYLGHNELRKPPLVMGHEFSGVVEEVGH 70 ++++ S PV PG + +RVA GICGS+ Y G P + +GHE G+VE +G Sbjct: 11 SLTMRSVERPVAGPGELLVRVAVAGICGSDRHMYKGEYPTAIP-VTLGHELCGIVEAIGD 69 Query: 71 GVTNVKIGDLVTANPLVTCGRCIHCLRGERQRCESRRIIGIDFPGAYAERVLVPSNQCYA 130 VT G+LVT +P + CG C C + CES IG+ G +AE V VP Q + Sbjct: 70 TVTRFTGGELVTVDPNIACGTCRACTQARPNLCESLTAIGVTRDGGFAEYVAVPQAQAFV 129 Query: 131 VK---DAIDGALVEPLACAVRAVGLARIKVGDTAVVIGAGIIGLMTVRLLGLSGAKRIAV 187 + D + GA EPLAC + A+ ARI+ GD+ ++G G+IGL+ V+L L+GA I + Sbjct: 130 LPAGLDPVHGAFSEPLACCIHAIDKARIRPGDSVAILGGGVIGLLMVQLARLAGAGEIIL 189 Query: 188 VDPNDERLKISQLWGATE----MAPNLGALLTDNHPQSFDCVIDAVGLSTTRRDSLNALI 243 + R + + GAT + + A + + D VI+ G+S T + L Sbjct: 190 ITRQQSRRQTALRLGATHAFDPTSSDTIASVREVTKGGADVVIECAGVSDTLQSGLKMAR 249 Query: 244 RGGRAVWIGLHEA 256 RGG V G+ A Sbjct: 250 RGGTFVLFGVTPA 262 Lambda K H 0.322 0.139 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 317 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 331 Length of database: 336 Length adjustment: 28 Effective length of query: 303 Effective length of database: 308 Effective search space: 93324 Effective search space used: 93324 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory