Align ABC transporter (characterized, see rationale)
to candidate WP_012759619.1 RLEG_RS21560 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= uniprot:A0A166QFW2 (381 letters) >NCBI__GCF_000023185.1:WP_012759619.1 Length = 358 Score = 368 bits (945), Expect = e-106 Identities = 195/350 (55%), Positives = 246/350 (70%), Gaps = 2/350 (0%) Query: 6 LDNVNKQLGGMRILRDVSLEIAAGEFVVFVGPSGCGKSTLLRLIAGLDSICGGDLLIDGR 65 L V K+ G + ++ + L I GEFVVFVGPSGCGKSTLLR+IAGL+ I GG LL+D Sbjct: 7 LQKVEKRYGSLDVIHGIDLTIDPGEFVVFVGPSGCGKSTLLRMIAGLEEITGGGLLLDNE 66 Query: 66 RVNDLEPRERGVGMVFQSYALYPHMSVYDNISFGLKLAKTDKTSLRERVLKTAQILQLDK 125 R+N++ P +RG+ MVFQSYALYPHMSVY N++FGL+ A K ++ +V + A+ILQ++K Sbjct: 67 RMNEVAPAKRGIAMVFQSYALYPHMSVYKNLAFGLETAGYKKADIQPKVKRAAEILQIEK 126 Query: 126 LLQRKPKELSGGQRQRVAMGRAMAREPDILLFDEPLSNLDASLRVQMRNEIARLHDRLGS 185 LL+RKPK LSGGQRQRVA+GRA+ REP I LFDEPLSNLDA LRVQMR EI+RLH LG+ Sbjct: 127 LLERKPKALSGGQRQRVAIGRAIVREPRIFLFDEPLSNLDAELRVQMRVEISRLHRSLGN 186 Query: 186 TMIYVTHDQVEAMTLADKIVVLNGGRVEQVGSPRELYERPASRFVAGFLGSPRMNFLSAR 245 TMIYVTHDQVEAMT+ADKIVVLN GR+EQVG+P +LY PA+RFVAGF+GSP+MNFL AR Sbjct: 187 TMIYVTHDQVEAMTMADKIVVLNSGRIEQVGAPLDLYNNPANRFVAGFIGSPKMNFLKAR 246 Query: 246 LQTPGETSLVDTLVWGITSLPFDSSNLAAGTPLSLGIRPEHVSL-KAADGTAGVVVTAVE 304 ++ GET + LP AG ++ GIRPEH+SL + A + V V VE Sbjct: 247 IEQVGETETSIHVCGNSVRLPRRLKG-GAGEEVTFGIRPEHLSLAEGAIALSTVNVDLVE 305 Query: 305 YLGSETYVHLETGQDEPLICRCEVSAGWQAGDRVELLLDLDNLHLFDADG 354 LG T ++ T ++ L + + G V+ D H+FDA G Sbjct: 306 NLGGATMLYTTTPDNQLLTVALDGQQKVERGANVKASFDPARCHVFDAAG 355 Lambda K H 0.320 0.137 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 382 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 381 Length of database: 358 Length adjustment: 30 Effective length of query: 351 Effective length of database: 328 Effective search space: 115128 Effective search space used: 115128 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory