Align ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized)
to candidate WP_012759619.1 RLEG_RS21560 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC
Query= reanno::Smeli:SMc03065 (362 letters) >NCBI__GCF_000023185.1:WP_012759619.1 Length = 358 Score = 379 bits (972), Expect = e-110 Identities = 203/358 (56%), Positives = 253/358 (70%), Gaps = 3/358 (0%) Query: 2 TGLLLKDIRKSYGAVDVIHGIDLDIKEGEFVVFVGPSGCGKSTLLRMIAGLEEITGGDMF 61 T ++L+ + K YG++DVIHGIDL I GEFVVFVGPSGCGKSTLLRMIAGLEEITGG + Sbjct: 3 TSVVLQKVEKRYGSLDVIHGIDLTIDPGEFVVFVGPSGCGKSTLLRMIAGLEEITGGGLL 62 Query: 62 IDGERVNDVPPSKRGIAMVFQSYALYPHMTVYDNMAFGMRIARESKEEIDRRVRGAADML 121 +D ER+N+V P+KRGIAMVFQSYALYPHM+VY N+AFG+ A K +I +V+ AA++L Sbjct: 63 LDNERMNEVAPAKRGIAMVFQSYALYPHMSVYKNLAFGLETAGYKKADIQPKVKRAAEIL 122 Query: 122 QLTPYLDRLPKALSGGQRQRVAIGRAICRNPKVFLFDEPLSNLDAALRVATRIEIAKLSE 181 Q+ L+R PKALSGGQRQRVAIGRAI R P++FLFDEPLSNLDA LRV R+EI++L Sbjct: 123 QIEKLLERKPKALSGGQRQRVAIGRAIVREPRIFLFDEPLSNLDAELRVQMRVEISRL-H 181 Query: 182 RMSDTTMIYVTHDQVEAMTLADRIVVLSAGHIEQVGAPLELYERPANLFVARFIGSPAMN 241 R TMIYVTHDQVEAMT+AD+IVVL++G IEQVGAPL+LY PAN FVA FIGSP MN Sbjct: 182 RSLGNTMIYVTHDQVEAMTMADKIVVLNSGRIEQVGAPLDLYNNPANRFVAGFIGSPKMN 241 Query: 242 VIPATITATGQQTAVSLAGGKSVTLDVPTNASENGKTASFGVRPEDLRVTEADDFLFEGT 301 + A I G+ G SV L G+ +FG+RPE L + E L Sbjct: 242 FLKARIEQVGETETSIHVCGNSVRLPRRLKGGA-GEEVTFGIRPEHLSLAEGAIALSTVN 300 Query: 302 VSIVEALGEVTLLYIEGLVENEPIIAKMPGIARVGRGDKVRFTADKAKLHLFDTNGQS 359 V +VE LG T+LY +N+ + + G +V RG V+ + D A+ H+FD G++ Sbjct: 301 VDLVENLGGATMLYTT-TPDNQLLTVALDGQQKVERGANVKASFDPARCHVFDAAGKT 357 Lambda K H 0.320 0.137 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 379 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 362 Length of database: 358 Length adjustment: 29 Effective length of query: 333 Effective length of database: 329 Effective search space: 109557 Effective search space used: 109557 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory