Align glycolaldehyde oxidoreductase small subunit (characterized)
to candidate WP_012755146.1 RLEG_RS23140 aldehyde dehydrogenase iron-sulfur subunit PaoA
Query= metacyc::MONOMER-18073 (163 letters) >NCBI__GCF_000023185.1:WP_012755146.1 Length = 215 Score = 128 bits (322), Expect = 5e-35 Identities = 67/163 (41%), Positives = 91/163 (55%), Gaps = 15/163 (9%) Query: 11 KIKVKVNGVLYERYVSPRILLVDFLREELGLTGTKIGCDTTTCGACTVLLNGKSVKSCTL 70 K+ VNG + V R L+D LRE L LTGTK GCD CGACTV+++G + SC Sbjct: 49 KVSFTVNGQNRDLEVDNRTSLLDALREHLHLTGTKKGCDHGQCGACTVMVDGHRINSCLT 108 Query: 71 FAVQADGAEITTIEGLSVDSKLHPIQEAFKENFALQCGFCTPGMIMQAYFLLKE------ 124 AV +G +ITTIEGL LHP+Q AF ++ QCG+CTPG I + +L+E Sbjct: 109 LAVMHEGDQITTIEGLGQPGNLHPMQTAFVKHDGFQCGYCTPGQICSSVAVLEEIKANIP 168 Query: 125 ---------NPNPSEEEVRDGLHGNICRCTGYQNIVKAVLDAS 158 + E+R+ + GNICRC Y NI+ A+ + + Sbjct: 169 SHVTSDLTAEAAVTAAEIRERMSGNICRCGAYSNIIDAISEVA 211 Lambda K H 0.322 0.138 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 117 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 163 Length of database: 215 Length adjustment: 20 Effective length of query: 143 Effective length of database: 195 Effective search space: 27885 Effective search space used: 27885 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 44 (21.6 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory