GapMind for catabolism of small carbon sources

 

Alignments for a candidate for pcaG in Klebsiella variicola At-22

Align protocatechuate 3,4-dioxygenase, beta chain; EC 1.13.11.3 (characterized)
to candidate WP_012968101.1 KVAR_RS12095 catechol 1,2-dioxygenase

Query= CharProtDB::CH_121290
         (241 letters)



>NCBI__GCF_000025465.1:WP_012968101.1
          Length = 308

 Score = 63.2 bits (152), Expect = 6e-15
 Identities = 41/125 (32%), Positives = 61/125 (48%), Gaps = 17/125 (13%)

Query: 71  DGLPIGERVIVHGYVRDQFGRPVKNALVEVWQANASGRYRHPNDQYIGAMDPNFGGCGRM 130
           DG   GE + +HG V+D  G+P+ NA+V++W AN  G Y      +      ++    R+
Sbjct: 125 DGTDAGEVMWLHGQVKDNQGQPIANAIVDIWHANTLGNY-----SFFDKSQSDYNLRRRI 179

Query: 131 LTDDNGYYVFRTIKPGPY------PWRNRINEW-----RPAHIHFSLIADGWAQRLISQF 179
            T  +G Y  R+I P  Y      P +  +++      RPAHIHF + A G  + L SQ 
Sbjct: 180 RTGADGRYSVRSIMPSGYGCPPDGPTQKLLDQLGRHGNRPAHIHFFVSAPG-HKHLTSQI 238

Query: 180 YFEGD 184
              GD
Sbjct: 239 NLSGD 243


Lambda     K      H
   0.321    0.139    0.439 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 198
Number of extensions: 9
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 241
Length of database: 308
Length adjustment: 25
Effective length of query: 216
Effective length of database: 283
Effective search space:    61128
Effective search space used:    61128
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 47 (22.7 bits)

This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory