Align ABC transporter for L-Arginine and L-Citrulline, periplasmic substrate-binding component (characterized)
to candidate WP_008805821.1 KVAR_RS17270 arginine ABC transporter substrate-binding protein ArtJ
Query= reanno::pseudo3_N2E3:AO353_03055 (258 letters) >NCBI__GCF_000025465.1:WP_008805821.1 Length = 243 Score = 179 bits (455), Expect = 4e-50 Identities = 101/251 (40%), Positives = 152/251 (60%), Gaps = 10/251 (3%) Query: 1 MKKLVLLGALALSVLSLPTFADEKPLKIGIEAAYPPFASKAPDGSIVGFDYDIGNALCEE 60 MKKLVL A L+ + A EK + G+ A YPPF S + IVGFD D+ ALC++ Sbjct: 1 MKKLVL--AALLTTFTFGAAAAEK-ISFGVSATYPPFESMDANNQIVGFDLDLAKALCKQ 57 Query: 61 MKVKCVWVEQEFDGLIPALKVRKIDAILSSMSITDDRKKSVDFTNKYYNTPARLVMKAGT 120 M+ +C + FD LIPALK +K DA++S M IT +R K V FT+ YY A ++ K Sbjct: 58 MQAECTFTNHAFDSLIPALKFKKYDAVISGMDITPERSKQVAFTDPYYANSALVIAK--K 115 Query: 121 QVSDNLAELKGKKIGVQRGSIHNRFAEEVLKPLGAEIKPYGSQNEIYLDVAAGRLDGTVA 180 + +LKGK+IG++ G+ H ++ ++ K + Y S +D+ GR+DG Sbjct: 116 DAFHSFDDLKGKRIGMENGTTHQKYLQD--KHPEVKTVAYDSYQNAIIDLKNGRIDGVFG 173 Query: 181 DATLLDDGFLKTDSGKGFAFVGPAFTDEKYFGDGIGIAVRKGDKAELDKINAAIVAIRAN 240 D ++++ +LKT+ G A P TD +YFG G+GIAVR +KA L+K+NAA+ AI+A+ Sbjct: 174 DTAVVNE-WLKTNPQLGAA--TPKVTDPQYFGTGLGIAVRPDNKALLEKLNAALKAIKAD 230 Query: 241 GKYKQIQDKYF 251 G Y++I +++F Sbjct: 231 GTYQKISNQWF 241 Lambda K H 0.318 0.138 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 193 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 243 Length adjustment: 24 Effective length of query: 234 Effective length of database: 219 Effective search space: 51246 Effective search space used: 51246 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory