Align 4-(gamma-glutamylamino)butanal dehydrogenase (EC 1.2.1.99) (characterized)
to candidate WP_008807572.1 KVAR_RS22260 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase
Query= BRENDA::P23883 (495 letters) >NCBI__GCF_000025465.1:WP_008807572.1 Length = 488 Score = 342 bits (876), Expect = 2e-98 Identities = 189/480 (39%), Positives = 286/480 (59%), Gaps = 17/480 (3%) Query: 23 FINGEYTAAAENETFETVDPVTQAPLAKIARGKSVDIDRAMSAARGVFERGDWSLSSPAK 82 +ING+ A A+ F T +P T LA++A G +I++A++AA+ F + W+ + Sbjct: 7 WINGKNVAGADY--FHTTNPATGEVLAEVASGGEAEINQAVAAAKEAFPK--WANLPMKE 62 Query: 83 RKAVLNKLADLMEAHAEELALLETLDTGKPIRHSLRDDIPGAARAIRWYAEAIDKVYGEV 142 R ++ +L DL++ + E+A +ET DTG PI + IP A+ ++AE ++ G+ Sbjct: 63 RARLMRRLGDLIDQNVPEIAAMETADTGLPIHQTKNVLIPRASHNFEFFAEVCQQMNGKT 122 Query: 143 ATTSSHELAMIVREPVGVIAAIVPWNFPLLLTCWKLGPALAAGNSVILKPSEKSPLSAIR 202 L + +PVGV A + PWN P + WK+ P LA GN+ +LK SE SPL+A R Sbjct: 123 YPVDDKMLNYTLVQPVGVCALVSPWNVPFMTATWKVAPCLALGNTAVLKMSELSPLTADR 182 Query: 203 LAGLAKEAGLPDGVLNVVTGFGHEAGQALSRHNDIDAIAFTGSTRTGKQLLKDAGDSNMK 262 L LA EAG+P GVLNVV G+G AG AL RH+D+ A++FTG T TG+ ++K+AG +K Sbjct: 183 LGELALEAGIPAGVLNVVQGYGATAGDALVRHHDVRAVSFTGGTATGRNIMKNAG---LK 239 Query: 263 RVWLEAGGKSANIVFADCPDLQQAASATAAGIFYNQGQVCIAGTRLLLEESIADEFLALL 322 + +E GGKS ++F D D+++A A IF G+ C AG+R+ +++SI EF+ Sbjct: 240 KYSMELGGKSPVLIFEDA-DIERALDAALFTIFSINGERCTAGSRIFIQQSIYPEFVKRF 298 Query: 323 KQQAQNWQPGHPLDPATTMGTLIDCAHADSVHSFIREGESKGQLLLDG---RNAGLAA-- 377 ++A + G P DP T +G LI H + V +IR G +G LL G + + L A Sbjct: 299 AERANRLRVGDPTDPNTQVGALISKQHWEKVSGYIRLGIEEGATLLAGGADKPSDLPAHL 358 Query: 378 ----AIGPTIFVDVDPNASLSREEIFGPVLVVTRFTSEEQALQLANDSQYGLGAAVWTRD 433 + PT+ DVD +++EEIFGPV + F E + L+LAND +YGL + +WT+D Sbjct: 359 KAGNFLRPTVLADVDNRMRVAQEEIFGPVACLLPFKDEAEGLRLANDVEYGLASYIWTQD 418 Query: 434 LSRAHRMSRRLKAGSVFVNNYNDGDMTVPFGGYKQSGNGRDKSLHALEKFTELKTIWISL 493 +S+ R++R ++AG VFVN N D+ PFGG K SG GR+ ++ E F E+K + IS+ Sbjct: 419 VSKVLRLARGIEAGMVFVNTQNVRDLRQPFGGVKASGTGREGGEYSFEVFAEMKNVCISM 478 Lambda K H 0.317 0.133 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 538 Number of extensions: 24 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 495 Length of database: 488 Length adjustment: 34 Effective length of query: 461 Effective length of database: 454 Effective search space: 209294 Effective search space used: 209294 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory