GapMind for catabolism of small carbon sources

 

Alignments for a candidate for nbaF in Klebsiella variicola At-22

Align 2-aminomuconate deaminase; EC 3.5.99.5 (characterized)
to candidate WP_004204505.1 KVAR_RS16570 pyrimidine utilization protein C

Query= SwissProt::Q9KWS2
         (142 letters)



>NCBI__GCF_000025465.1:WP_004204505.1
          Length = 130

 Score = 55.5 bits (132), Expect = 3e-13
 Identities = 38/126 (30%), Positives = 59/126 (46%), Gaps = 10/126 (7%)

Query: 14  GKAKPMGSFPHVKRAGDFLFVSGTSSRRPDNTFVGAEPDDTGRPRPNIELQTREVISNIR 73
           G   P+  F     A   ++VSGT      N  V       G P+     QTR V+  I+
Sbjct: 10  GTTTPIAPFVPGTLADGVVYVSGTLPFDKQNNVV-----HIGDPKA----QTRHVLETIK 60

Query: 74  DILQSVGADLGDVVEVCSYLVNMNDFAAYNKVYAEFFDATGPARTTVAVHQLPHPQLVIE 133
            ++++ G  + DV     ++ +  ++AA N+VYAEFF    PAR  +    L  P  ++E
Sbjct: 61  SVIETAGGSMADVTFNSIFITDWTNYAAINEVYAEFFPGDKPARFCIQC-GLVKPDALVE 119

Query: 134 IKVVAY 139
           I  VA+
Sbjct: 120 IASVAH 125


Lambda     K      H
   0.318    0.135    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 45
Number of extensions: 3
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 142
Length of database: 130
Length adjustment: 15
Effective length of query: 127
Effective length of database: 115
Effective search space:    14605
Effective search space used:    14605
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 42 (20.8 bits)

This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory