Align D-lactate oxidase, FAD binding subunit (EC 1.1.3.15) (characterized)
to candidate WP_012991253.1 THAL_RS01035 FAD-linked oxidase C-terminal domain-containing protein
Query= reanno::Phaeo:GFF2924 (366 letters) >NCBI__GCF_000025605.1:WP_012991253.1 Length = 464 Score = 77.4 bits (189), Expect = 7e-19 Identities = 53/156 (33%), Positives = 80/156 (51%), Gaps = 19/156 (12%) Query: 43 NGVTLYEPGALTLVVQAGTSVEEVQALLAGENQRLAFEPMDHRGLLGTKGTPTIGGVFAA 102 N V EPG +T +Q E V++L F P D + TIGG A Sbjct: 109 NAVAYAEPGVVTAQLQ-----EYVESLGL-------FYPPDPSSFKYS----TIGGNIAE 152 Query: 103 NVSGPRRIQCGAARDFLLGVRFVDGRGDVLSNGGRVMKNVTGYDLVKLMAGSHGTLGVLS 162 N GPR ++ G R+++LG+ V G + GG V+K+V GYD+ +L+ GS GTLG+++ Sbjct: 153 NAGGPRCLKYGVTREYVLGLTAVIKEGKTVKTGGPVIKDVAGYDITRLLVGSEGTLGLIT 212 Query: 163 EVSLKVLPCSEACATVTV---HVADLTSAVAAMSTA 195 E LK++P A T ++ D+ AV + T+ Sbjct: 213 EAVLKLIPKPRARLTALAIFHNLEDVGHAVTKIFTS 248 Lambda K H 0.318 0.136 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 360 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 366 Length of database: 464 Length adjustment: 31 Effective length of query: 335 Effective length of database: 433 Effective search space: 145055 Effective search space used: 145055 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory