Align acyl CoA carboxylase biotin carboxylase subunit (EC 2.1.3.15; EC 6.4.1.3; EC 6.3.4.14) (characterized)
to candidate WP_012991829.1 THAL_RS03990 acetyl-CoA carboxylase biotin carboxylase subunit
Query= metacyc::MONOMER-13597 (509 letters) >NCBI__GCF_000025605.1:WP_012991829.1 Length = 445 Score = 385 bits (988), Expect = e-111 Identities = 207/444 (46%), Positives = 288/444 (64%), Gaps = 9/444 (2%) Query: 7 VLVANRGEIATRVLKAIKEMGMTAIAVYSEADKYAVHTKYADEAYYIGKAPALDSYLNIE 66 VL+ANRGEIA RV++A +E+G+ ++VYSEADK ++H K + + IG A SYL+I Sbjct: 6 VLIANRGEIAVRVIRACRELGIHTVSVYSEADKDSMHVKLSHRSICIGPPEASKSYLDIP 65 Query: 67 HIIDAAEKAHVDAIHPGYGFLSENAEFAEAVEKAGITFIGPSSEVMRKIKDKLDGKRLAN 126 I+ A E + DA+HPGYGFLSEN +FAE V + FIGP V+ I DK+ + LA Sbjct: 66 RIMSALEVSGADAVHPGYGFLSENPKFAEVVNASKRVFIGPPPHVLELIGDKVKARELAK 125 Query: 127 MAGVPTAPGSDGPVTSIDEALKLAEKIGYPIMVKAASGGGGVGITRVDNQDQLMDVWERN 186 G+P PGSDGPV +A+++A IGYP+++KAA GGGG GI V N+ +L + Sbjct: 126 KVGLPLLPGSDGPV-DFKKAVEIANSIGYPVVIKAAGGGGGRGIRVVHNERELREKLPLA 184 Query: 187 KRLAYQAFGKADLFIEKYAVNPRHIEFQLIGDKYGNYVVAWERECTIQRRNQKLIEEAPS 246 + A AFG ++IEKY +NP+HIE Q++ D+YGN V EREC+IQRR QKL+EEAPS Sbjct: 185 MQEAQVAFGDNRVYIEKYLINPKHIEVQVLADRYGNVVCLGERECSIQRRYQKLVEEAPS 244 Query: 247 PALKMEERESMFEPIIKFGKLINYFTLGTFETAFSDVSRDFYFLELNKRLQVEHPTTELI 306 ++ ++R+ + E + +F K + Y GT E D +FYF+E+N R+QVEHP TE++ Sbjct: 245 VSITDQQRKILEEGVTEFCKALGYVGAGTVE-FLMDQDGNFYFMEMNGRIQVEHPVTEMV 303 Query: 307 FRIDLVKLQIKLAAGEHLPFSQEDLNKRVRGTAIEYRINAEDALNNFTGSSGFVTYYREP 366 ID+VK QIK+A GE L + + RG AIE+RINAED N F S G V P Sbjct: 304 TGIDIVKWQIKIAEGEKLKLGEVE----NRGYAIEFRINAEDP-NTFMPSPGTVETLYLP 358 Query: 367 TGPGVRVDSGIESGSYVPPYYDSLVSKLIVYGESREYAIQAGIRALADYKI--GGIKTTI 424 GPG+RVD+ + G VPPYYDSL+ KL+V+G+ RE AI G RAL + I G+KT + Sbjct: 359 GGPGIRVDTHVYCGYTVPPYYDSLLLKLVVWGKDREEAIMRGRRALEELVITGKGLKTNV 418 Query: 425 ELYKWIMQDPDFQEGKFSTSYISQ 448 E +K ++ +F+EG+ ++ + Sbjct: 419 EFHKRVVATREFREGRHHVRFVEE 442 Lambda K H 0.317 0.135 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 614 Number of extensions: 30 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 509 Length of database: 445 Length adjustment: 33 Effective length of query: 476 Effective length of database: 412 Effective search space: 196112 Effective search space used: 196112 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory