GapMind for catabolism of small carbon sources

 

Protein WP_256788748.1 in Frankia alni ACN14a

Annotation: NCBI__GCF_000058485.1:WP_256788748.1

Length: 206 amino acids

Source: GCF_000058485.1 in NCBI

Candidate for 17 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
L-glutamate catabolism gluC med GluC aka CGL1952, component of Glutamate porter (characterized) 41% 93% 141.4 Probable glutamine ABC transporter permease protein GlnM 37% 139.4
L-glutamate catabolism gltJ lo Amino acid ABC transporter membrane protein, component of Amino acid transporter, AatJMQP. Probably transports L-glutamic acid, D-glutamine acid, L-glutamine and N-acetyl L-glutamic acid (Johnson et al. 2008). Very similar to 3.A.1.3.19 of P. putida (characterized) 34% 86% 115.2 GluC aka CGL1952, component of Glutamate porter 41% 141.4
L-asparagine catabolism aatQ lo Glutamate/aspartate import permease protein GltJ (characterized) 32% 86% 112.1 GluC aka CGL1952, component of Glutamate porter 41% 141.4
L-aspartate catabolism aatQ lo Glutamate/aspartate import permease protein GltJ (characterized) 32% 86% 112.1 GluC aka CGL1952, component of Glutamate porter 41% 141.4
L-asparagine catabolism natH lo Amino acid ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine (characterized, see rationale) 32% 53% 104 GluC aka CGL1952, component of Glutamate porter 41% 141.4
L-aspartate catabolism natH lo Amino acid ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine (characterized, see rationale) 32% 53% 104 GluC aka CGL1952, component of Glutamate porter 41% 141.4
D-glucosamine (chitosamine) catabolism AO353_21715 lo ABC transporter for D-Glucosamine, permease component 2 (characterized) 33% 91% 99.4 GluC aka CGL1952, component of Glutamate porter 41% 141.4
L-glutamate catabolism gluD lo GluD aka CGL1953, component of Glutamate porter (characterized) 31% 75% 93.2 GluC aka CGL1952, component of Glutamate porter 41% 141.4
L-asparagine catabolism aapQ lo AapQ, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 33% 52% 83.6 GluC aka CGL1952, component of Glutamate porter 41% 141.4
L-aspartate catabolism aapQ lo AapQ, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 33% 52% 83.6 GluC aka CGL1952, component of Glutamate porter 41% 141.4
L-glutamate catabolism aapQ lo AapQ, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 33% 52% 83.6 GluC aka CGL1952, component of Glutamate porter 41% 141.4
L-histidine catabolism aapQ lo AapQ, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 33% 52% 83.6 GluC aka CGL1952, component of Glutamate porter 41% 141.4
L-leucine catabolism aapQ lo AapQ, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 33% 52% 83.6 GluC aka CGL1952, component of Glutamate porter 41% 141.4
L-proline catabolism aapQ lo AapQ, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 33% 52% 83.6 GluC aka CGL1952, component of Glutamate porter 41% 141.4
L-arginine catabolism artM lo L-Arginine ABC transporter, permease protein AotM (characterized) 30% 86% 81.6 GluC aka CGL1952, component of Glutamate porter 41% 141.4
L-asparagine catabolism bgtB' lo ABC-type permease for basic amino acids and glutamine (characterized, see rationale) 31% 53% 75.1 GluC aka CGL1952, component of Glutamate porter 41% 141.4
L-aspartate catabolism bgtB' lo ABC-type permease for basic amino acids and glutamine (characterized, see rationale) 31% 53% 75.1 GluC aka CGL1952, component of Glutamate porter 41% 141.4

Sequence Analysis Tools

View WP_256788748.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MFAEGFRRTVGLSLFAAIAALILGTALAAMRVSPVPPLRWLGTAYVEIVRNTPLTVVFFF
VVFVLPQVDIVFSYFTFAVVALSIYHGALVCEAVRSGINGVDLGQAEAARALGLTFTQSL
RMIVLPQAFRNVLQPLGSVISALIRNTSIAAAFGVQELTGVVQRLTTANPDSVIAVLLGG
VVAYLILTLALAGALALTERRVARAR

This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory