Align ABC transporter for L-Arginine and L-Citrulline, permease component 2 (characterized)
to candidate WP_011607042.1 FRAAL_RS26085 amino acid ABC transporter permease
Query= reanno::pseudo1_N1B4:Pf1N1B4_3433 (232 letters) >NCBI__GCF_000058485.1:WP_011607042.1 Length = 333 Score = 119 bits (299), Expect = 6e-32 Identities = 72/210 (34%), Positives = 113/210 (53%), Gaps = 17/210 (8%) Query: 16 LGGLVTTLKLLALSLFFGLLAALPLGLMRVSKQPVVNMSAWLFTYVIRGTPMLVQ-LFLI 74 L GL T+ L +++ G++ + L ++R+S PVV +AWL+ + RGTP+LVQ LF Sbjct: 105 LRGLWATVYLTVIAMAIGIVGGIVLAILRMSPNPVVAGAAWLYIWFFRGTPLLVQILFWS 164 Query: 75 YYGLA------------QFEAVRESFLWPWLSSATFCACLAFAINTSAYTAEIIAGSLRA 122 + G F + + + P ++A L +N +AY AEI+ + Sbjct: 165 FVGALYPRLSLGIPFGPSFVSGDANHIVPLFAAAV----LGLGLNEAAYMAEIVRAGING 220 Query: 123 TPNGEIEAAKAMGMSRIKMYKRILLPSALRRALPQYSNEVIMMLQTTSLASIVTLIDITG 182 G+ EAA A+GMSR +RI+LP A+R +P NE I ML+TTSL S+++ ++ Sbjct: 221 VDAGQTEAASALGMSRALALRRIVLPQAMRTIIPPTGNETISMLKTTSLVSVISYNELLN 280 Query: 183 AARTVNAQFYLPFEAYITAGVFYLCLTFIL 212 A R V A+ + I A ++YL LT +L Sbjct: 281 ATRIVYARTFQTIPLLIVAALWYLALTSVL 310 Lambda K H 0.330 0.140 0.427 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 154 Number of extensions: 2 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 232 Length of database: 333 Length adjustment: 25 Effective length of query: 207 Effective length of database: 308 Effective search space: 63756 Effective search space used: 63756 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory