Align ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, permease component 2 (characterized)
to candidate WP_011607042.1 FRAAL_RS26085 amino acid ABC transporter permease
Query= reanno::Smeli:SMc02120 (384 letters) >NCBI__GCF_000058485.1:WP_011607042.1 Length = 333 Score = 104 bits (260), Expect = 3e-27 Identities = 74/217 (34%), Positives = 115/217 (52%), Gaps = 18/217 (8%) Query: 144 LLLLVALPILSAILLPG---GWFGLTYVETPLWGGLMVTLVLSFVGIAVSLPLGILLALG 200 +L+L A+ + S + P G G P+ GL T+ L+ + +A+ + GI+LA+ Sbjct: 73 ILVLAAMGVHSLVTNPHFQWGTVGDYLFAEPVLRGLWATVYLTVIAMAIGIVGGIVLAIL 132 Query: 201 RRSNMPVIKMLCTVFIEVIRGVPLIT-VLFMASV-----MLPLFLPQGVTFDK------- 247 R S PV+ ++I RG PL+ +LF + V L L +P G +F Sbjct: 133 RMSPNPVVAGAAWLYIWFFRGTPLLVQILFWSFVGALYPRLSLGIPFGPSFVSGDANHIV 192 Query: 248 --FLRALIGVSLFASAYMAEVVRGGLQAIPKGQYEGADSLGLSFWQKMGFIVLPQALKLV 305 F A++G+ L +AYMAE+VR G+ + GQ E A +LG+S + IVLPQA++ + Sbjct: 193 PLFAAAVLGLGLNEAAYMAEIVRAGINGVDAGQTEAASALGMSRALALRRIVLPQAMRTI 252 Query: 306 IPGIVNTFIGLFKDTSLVSIIGMFDLLGIVRLNFSDT 342 IP N I + K TSLVS+I +LL R+ ++ T Sbjct: 253 IPPTGNETISMLKTTSLVSVISYNELLNATRIVYART 289 Lambda K H 0.329 0.144 0.454 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 372 Number of extensions: 22 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 384 Length of database: 333 Length adjustment: 29 Effective length of query: 355 Effective length of database: 304 Effective search space: 107920 Effective search space used: 107920 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory