Align ABC transporter for L-Lysine, permease component 1 (characterized)
to candidate WP_011607042.1 FRAAL_RS26085 amino acid ABC transporter permease
Query= reanno::pseudo5_N2C3_1:AO356_05500 (242 letters) >NCBI__GCF_000058485.1:WP_011607042.1 Length = 333 Score = 114 bits (284), Expect = 3e-30 Identities = 75/225 (33%), Positives = 114/225 (50%), Gaps = 7/225 (3%) Query: 19 FGPLLMQGTWMTIKLSALSLLLSVLLGLLGASAKLSRVKLLRIPAQLYTTLIRGVPDLVL 78 F +++G W T+ L+ +++ + ++ G++ A ++S ++ A LY RG P LV Sbjct: 100 FAEPVLRGLWATVYLTVIAMAIGIVGGIVLAILRMSPNPVVAGAAWLYIWFFRGTPLLVQ 159 Query: 79 MLL------IFYSLQTWLTSFTDFMEWEYIEIDP-FGAGVITLGFIYGAYFTETFRGAIL 131 +L ++ L + F+ + I P F A V+ LG AY E R I Sbjct: 160 ILFWSFVGALYPRLSLGIPFGPSFVSGDANHIVPLFAAAVLGLGLNEAAYMAEIVRAGIN 219 Query: 132 AVPRGQVEAATAYGLKRGQRFRFVVFPQMMRFALPGIGNNWMVMLKATALVSIIGLADLV 191 V GQ EAA+A G+ R R +V PQ MR +P GN + MLK T+LVS+I +L+ Sbjct: 220 GVDAGQTEAASALGMSRALALRRIVLPQAMRTIIPPTGNETISMLKTTSLVSVISYNELL 279 Query: 192 KAAQDAGKSTYQLFYFLVLAALIYLLITSASNFILRWLERRYAAG 236 A + T+Q L++AAL YL +TS LERR+A G Sbjct: 280 NATRIVYARTFQTIPLLIVAALWYLALTSVLTLGQHQLERRFARG 324 Lambda K H 0.329 0.142 0.423 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 180 Number of extensions: 4 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 242 Length of database: 333 Length adjustment: 26 Effective length of query: 216 Effective length of database: 307 Effective search space: 66312 Effective search space used: 66312 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory