Align High-affinity branched-chain amino acid transport ATP-binding protein (characterized, see rationale)
to candidate WP_011601970.1 FRAAL_RS03140 ABC transporter ATP-binding protein
Query= uniprot:A0A159ZWL6 (233 letters) >NCBI__GCF_000058485.1:WP_011601970.1 Length = 267 Score = 239 bits (610), Expect = 4e-68 Identities = 123/232 (53%), Positives = 166/232 (71%), Gaps = 1/232 (0%) Query: 1 MLQFENVSTFYGKIQALHSVNVEVRQGEIVTLIGANGAGKSTLLMTLCGSPQAHSGSIRY 60 +L +V YG + AL V++EV +GEIVTL+GANGAGK+T L T+ G + +G +R Sbjct: 2 LLTLSDVEVAYGAVTALRGVSLEVAEGEIVTLLGANGAGKTTTLRTISGLLRPKAGEVRL 61 Query: 61 MGEELVGQDSSHIMRKSIAVVPEGRRVFARLTVEENLAMGGFFTDKGDYQEQMDKVLHLF 120 G L + ++ ++ VPEGRRVF ++V ENL MG + D+ + +++V+ LF Sbjct: 62 DGRPLSSIPAHGLVGAGVSHVPEGRRVFPSMSVRENLLMGAYH-DRRHARADLERVVALF 120 Query: 121 PRLKERFTQRGGTMSGGEQQMLAIGRALMSKPKLLLLDEPSLGLAPIIIQQIFDIIEQLR 180 PRL ER Q GGT+SGGEQQMLAIGRALMS+P+L+LLDEPS+GLAP+I+Q IF++I ++ Sbjct: 121 PRLAERIGQAGGTLSGGEQQMLAIGRALMSRPRLILLDEPSMGLAPMIVQTIFEVIAEIN 180 Query: 181 KDGVTVFLVEQNANQALKIADRAYVLENGRVVMQGTGEALLTDPKVREAYLG 232 ++GV V LVEQNA AL+IA R YVLE GRVV+ T ALL D +VR+AYLG Sbjct: 181 REGVAVLLVEQNAASALRIAGRGYVLETGRVVLADTAAALLADDRVRQAYLG 232 Lambda K H 0.320 0.137 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 203 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 233 Length of database: 267 Length adjustment: 24 Effective length of query: 209 Effective length of database: 243 Effective search space: 50787 Effective search space used: 50787 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory