Align ABC-type branched-chain amino acid transport system, ATPase component protein (characterized, see rationale)
to candidate WP_011601970.1 FRAAL_RS03140 ABC transporter ATP-binding protein
Query= uniprot:D8IUY7 (241 letters) >NCBI__GCF_000058485.1:WP_011601970.1 Length = 267 Score = 238 bits (608), Expect = 7e-68 Identities = 126/236 (53%), Positives = 167/236 (70%), Gaps = 4/236 (1%) Query: 5 ILKVQQLSVAYGGIQAVKGIDLEVNEGELVTLIGANGAGKTTTLKAITGTLPASRVEGHI 64 +L + + VAYG + A++G+ LEV EGE+VTL+GANGAGKTTTL+ I+G L G + Sbjct: 2 LLTLSDVEVAYGAVTALRGVSLEVAEGEIVTLLGANGAGKTTTLRTISGLLRPKA--GEV 59 Query: 65 EYLGQPLKGKKSFELVKDKLAMVPEGRGVFTRMSIQENLLMGAYTSDDKGQIAADIDKWF 124 G+PL + LV ++ VPEGR VF MS++ENLLMGAY D+ AD+++ Sbjct: 60 RLDGRPLSSIPAHGLVGAGVSHVPEGRRVFPSMSVRENLLMGAY--HDRRHARADLERVV 117 Query: 125 AVFPRLKERAAQMAGTLSGGEQQMLAMARALMSHPKLLLLDEPSMGLSPIMVEKIFEVIR 184 A+FPRL ER Q GTLSGGEQQMLA+ RALMS P+L+LLDEPSMGL+P++V+ IFEVI Sbjct: 118 ALFPRLAERIGQAGGTLSGGEQQMLAIGRALMSRPRLILLDEPSMGLAPMIVQTIFEVIA 177 Query: 185 NVSAQGITILLVEQNAKLALEAAHRGYVMESGLITMQGQAQQMLDDPRVKAAYLGE 240 ++ +G+ +LLVEQNA AL A RGYV+E+G + + A +L D RV+ AYLGE Sbjct: 178 EINREGVAVLLVEQNAASALRIAGRGYVLETGRVVLADTAAALLADDRVRQAYLGE 233 Lambda K H 0.317 0.134 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 199 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 241 Length of database: 267 Length adjustment: 24 Effective length of query: 217 Effective length of database: 243 Effective search space: 52731 Effective search space used: 52731 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory