Align ABC transporter ATP-binding protein (characterized, see rationale)
to candidate WP_011605976.1 FRAAL_RS21210 ABC transporter ATP-binding protein
Query= uniprot:A0A165KC78 (242 letters) >NCBI__GCF_000058485.1:WP_011605976.1 Length = 242 Score = 172 bits (437), Expect = 4e-48 Identities = 96/237 (40%), Positives = 145/237 (61%), Gaps = 8/237 (3%) Query: 8 VLLQVKGLKVAYGGIQAVKGVDFEVREGELVSLIGSNGAGKTTTMKAITGTLSMNDGNIE 67 VLLQ +GL Y + V+G + +REGE+V+L+G NGAGKTT + + G L G + Sbjct: 3 VLLQTRGLNAGYDRVPVVRGFELTLREGEVVALLGPNGAGKTTVLLTLAGLLPALGGEVA 62 Query: 68 YLGKSIKGKGAWDLVKEGLVMVPEGRGVFARMTITENLQMGAYIRKDKAGILADIEKMFT 127 G+ + L + G+V+VP+ R +F +T ENLQ+G + K G+ ++++ Sbjct: 63 VHGQDVHRASPRALSRLGVVLVPDDRSLFTTLTSRENLQLG----RVKGGL--SVDEVLD 116 Query: 128 IFPRLRERKDQLAGTMSGGEQQMLAMGRALMSQPKVLLLDEPSMGLSPIMVDKIFEVVRD 187 FP LR+R D AG +SGGEQQMLA+GRAL+ +P++LL+DE SMGL+P++V ++ VVR Sbjct: 117 YFPALRKRLDVRAGMLSGGEQQMLAIGRALVQRPRILLIDELSMGLAPVIVQELLPVVRA 176 Query: 188 VYA-LGVTIVLVEQNASRALAIADRGYVMESGLITMTGPGQQLLNDPK-VRAAYLGE 242 V +VLVEQ+ + IAD V+ G ++GP +L +P+ + AYL E Sbjct: 177 VATDTSAAVVLVEQHVHLVMGIADHAIVLAHGEEVLSGPAAELRANPELLERAYLSE 233 Lambda K H 0.317 0.136 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 173 Number of extensions: 6 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 242 Length of database: 242 Length adjustment: 23 Effective length of query: 219 Effective length of database: 219 Effective search space: 47961 Effective search space used: 47961 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory