Align High-affinity branched-chain amino acid transport ATP-binding protein BraG, component of Branched chain amino acid uptake transporter. Transports alanine (characterized)
to candidate WP_011605976.1 FRAAL_RS21210 ABC transporter ATP-binding protein
Query= TCDB::P21630 (233 letters) >NCBI__GCF_000058485.1:WP_011605976.1 Length = 242 Score = 161 bits (408), Expect = 9e-45 Identities = 85/223 (38%), Positives = 140/223 (62%), Gaps = 7/223 (3%) Query: 11 YGKIQALHDVSVEVKKGEIVTLIGANGAGKSTLLMTLCGSPQAASGSIRYEGEELVGLPS 70 Y ++ + + +++GE+V L+G NGAGK+T+L+TL G A G + G+++ Sbjct: 14 YDRVPVVRGFELTLREGEVVALLGPNGAGKTTVLLTLAGLLPALGGEVAVHGQDVHRASP 73 Query: 71 STIMRKSIAVVPEGRRVFSRLTVEENLAMGGFFTDKDDYQVQMDKVLELFPRLKERYEQR 130 + R + +VP+ R +F+ LT ENL +G + + +D+VL+ FP L++R + R Sbjct: 74 RALSRLGVVLVPDDRSLFTTLTSRENLQLG-----RVKGGLSVDEVLDYFPALRKRLDVR 128 Query: 131 AGTMSGGEQQMLAIGRALMSKPKLLLLDEPSLGLAPIIIQQIFEIIEQLRRE-GVTVFLV 189 AG +SGGEQQMLAIGRAL+ +P++LL+DE S+GLAP+I+Q++ ++ + + V LV Sbjct: 129 AGMLSGGEQQMLAIGRALVQRPRILLIDELSMGLAPVIVQELLPVVRAVATDTSAAVVLV 188 Query: 190 EQNANQALKLADRAYVLENGRIVMHDTGAALLTNPKVRD-AYL 231 EQ+ + + +AD A VL +G V+ A L NP++ + AYL Sbjct: 189 EQHVHLVMGIADHAIVLAHGEEVLSGPAAELRANPELLERAYL 231 Lambda K H 0.318 0.136 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 140 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 233 Length of database: 242 Length adjustment: 23 Effective length of query: 210 Effective length of database: 219 Effective search space: 45990 Effective search space used: 45990 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory