Align NatA, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized)
to candidate WP_011601969.1 FRAAL_RS03135 ABC transporter ATP-binding protein
Query= TCDB::Q7A2H0 (260 letters) >NCBI__GCF_000058485.1:WP_011601969.1 Length = 320 Score = 157 bits (397), Expect = 3e-43 Identities = 96/254 (37%), Positives = 142/254 (55%), Gaps = 6/254 (2%) Query: 11 LLAASGLCKSFGGIKAVQEARIEVAQGSITGLIGPNGAGKTTLFNLLSNFIRPDKGRVIF 70 ++ A L FGG+ ++ + +G I +IGPNGAGKT+LFN L+ RP +G V F Sbjct: 18 VVEARDLALRFGGVTSLDGVSLRQRRGEILAVIGPNGAGKTSLFNCLTGAYRPQEGSVTF 77 Query: 71 DGEP-----IQQLQPHQIAQQGMVRTFQVARTLSRLSVLENMLLAAQKQTGENFWQVQLQ 125 P + +PH I + G+ RTFQ R LS LEN+ + + + L Sbjct: 78 WPRPDGPTELVGRRPHAITRLGVARTFQNIRLFPALSALENVQIGTEVRQRYGPVGAILG 137 Query: 126 PQVVVKEEKQLQEQAMFLLESVGLAKKAYEYAGGLSGGQRKLLEMGRALMTNPKLILLDE 185 + E+ A+ LL+ VGL+ + +E A L G+++ LE+ RAL T P L+LLDE Sbjct: 138 LPHARRAERDGVRHALSLLDLVGLSHRTHELAASLPYGEQRRLEIARALGTGPSLLLLDE 197 Query: 186 PAAGVNPRLIDDICDRILTWNRQDGMTFLIIEHNMDVIMSLCDRVWVLAEGQNLADGTPA 245 PAAG NP D+ ++T G++ L+IEH+M ++MS+ V VL G+ +A GTP Sbjct: 198 PAAGTNPAEKRDLA-ALITRIAGTGVSVLLIEHDMRLVMSVATSVVVLNFGRVIAHGTPG 256 Query: 246 EIQTNSQVLEAYLG 259 E+Q + V+EAYLG Sbjct: 257 EVQRDPAVIEAYLG 270 Lambda K H 0.319 0.136 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 192 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 320 Length adjustment: 26 Effective length of query: 234 Effective length of database: 294 Effective search space: 68796 Effective search space used: 68796 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory