Align isobutanoate/2-methylbutanoate--CoA ligase (EC 6.2.1.1) (characterized)
to candidate WP_011423856.1 RHE_RS02425 long-chain fatty acid--CoA ligase
Query= metacyc::MONOMER-20125 (556 letters) >NCBI__GCF_000092045.1:WP_011423856.1 Length = 566 Score = 148 bits (374), Expect = 5e-40 Identities = 157/568 (27%), Positives = 249/568 (43%), Gaps = 65/568 (11%) Query: 8 PASSSPLTPLGF---LERAATVYGDCTSVVYDAVSYTWSQTHRRCLCLASSIASLGIENG 64 PA PL LE++ Y D T S ++ + +A+ + S+G+E G Sbjct: 26 PAELPPLEHASLAELLEKSCARYADRTVFSSMGKSMSYRDLESQTRKVAAWLQSIGLEKG 85 Query: 65 HVVSVLAPNVPQMYELHFAVPMAGAILNAVNLRLDARTISILLHHSESKLIFV-DHLSRD 123 V+V+ PNV Q +A+ AG ++ VN R + L S +K IFV ++ +R Sbjct: 86 DRVAVMMPNVLQNPVATYAILRAGLVVVNVNPLYTPRELEHQLRDSGAKAIFVLENFART 145 Query: 124 L------------ILEAIA--LFPKQAPVPRLVFMADESESGNSSELGKEFFCSYKDLID 169 + ++ ++ L PK V +V + S K S+ ++ Sbjct: 146 VEQVLNKTDLRHVVVTSLGEMLGPKGLMVNFVVRKVKKLVPSWSIPQHK----SFSQVLR 201 Query: 170 RGDPDFKWVMPKSEWDPMILNYTSGTTSSPKGVVHCHRGIFIMTVDSLI----DWGVPKQ 225 G + + L YT GTT KG V H+ + + + + KQ Sbjct: 202 EGAKKSLQPVTLAGGHIAFLQYTGGTTGVAKGAVLTHQNLLANKLQLSLWLRSAFQRKKQ 261 Query: 226 PV---YLWTLPMFHANGWSYPWGMA-AVGGTNICLRKFDSEIIYDMIKRHGVTHMC---G 278 P +L LP++H + M ++G NI + + I ++K G +++ G Sbjct: 262 PEVLNFLCALPLYHIFALTVNSLMGMSLGAHNILIA--NPRDIPGLVKEFGKSNIHIFPG 319 Query: 279 APVVLNMLSNAPGSEPLKTTVQIMTAGA----PPPSAVLFRTESLGFAVSHGYGLTETAG 334 + N L N L + IM+ G P A + ++ G A++ GYGL+ET+ Sbjct: 320 LNTLFNALMNNAEFAKLDFSSLIMSLGGGMAVQRPVAERW-LKTTGTAITEGYGLSETS- 377 Query: 335 LVVSCAWKKEWNHLPATERARLKSRQGVGTV----MQTKIDVVDPVTGAAVKRDGSTLGE 390 P R S + G++ T++D+ D G ++ +GE Sbjct: 378 --------------PVATANRFDSIEFTGSIGLPIPSTELDIRDE-EGRSLPL--GEIGE 420 Query: 391 VVLRGGSVMLGYLKDPEGTAKSMTADGWFYTGDVGVMHPDGYLEIKDRSKDVIISGGENL 450 + +RG VM GY + PE TA+ MTADG+F +GD+G M GY +I DR KD+I+ G N+ Sbjct: 421 ICIRGPQVMAGYWQKPEETARVMTADGYFRSGDMGFMDERGYTKIVDRKKDMILVSGFNV 480 Query: 451 SSVEVESILYSHPDILEAAVVARPDEFWGETPCAFVSLKKGLTKKPTEKEIVEYCRSKLP 510 E+E + H ILEAA V PD GE FV K TE E+ +C + L Sbjct: 481 YPNEIEEVAAMHAGILEAAAVGVPDGHSGEAVKLFVVRK---DPNLTEAEVRAHCIANLT 537 Query: 511 RYMVPKTVVFKEELPKTSTGKVQKFILR 538 Y P+ + F+ ELPK+ GK+ + LR Sbjct: 538 NYKRPRFIEFRTELPKSPVGKILRKDLR 565 Lambda K H 0.319 0.135 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 740 Number of extensions: 42 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 556 Length of database: 566 Length adjustment: 36 Effective length of query: 520 Effective length of database: 530 Effective search space: 275600 Effective search space used: 275600 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory