Align protocatechuate 3,4-dioxygenase (subunit 1/2) (EC 1.13.11.3) (characterized)
to candidate WP_011427915.1 RHE_RS24310 protocatechuate 3,4-dioxygenase subunit beta
Query= BRENDA::A0A193DXP2 (246 letters) >NCBI__GCF_000092045.1:WP_011427915.1 Length = 249 Score = 411 bits (1057), Expect = e-120 Identities = 193/245 (78%), Positives = 213/245 (86%) Query: 2 SNQPPETGPFFARNRDIHPLAYAPGYKTSILRSPQRALISLEGTKSEITGPVFGHGMLNP 61 +N PETG FFAR+R H A PGYKTS+LR+PQRAL+SL+GT SEITGPVFGH M+ Sbjct: 5 ANSKPETGAFFARDRAWHAPALTPGYKTSVLRAPQRALLSLDGTISEITGPVFGHSMIGE 64 Query: 62 LDNDLILNYARPGEMPVGPRILVHGRVLDERGRGVDGALVEFWQANAGGRYRHKKESYLA 121 LDNDLILNYARPGE +G RI+VHGRVLDER + V GALVEFWQANAGGRYRHKKE+YLA Sbjct: 65 LDNDLILNYARPGESAIGERIIVHGRVLDERAKPVAGALVEFWQANAGGRYRHKKETYLA 124 Query: 122 AIDPNFGGVGRTITDENGYYWFKTIQPGAYPWPNGVNDWRPAHIHFSIFGHGFAQRLITQ 181 AIDPNFGG GR ITDE G Y F+T++PGAYPWPNGVNDWRPAHIHFSIFGHGFAQRLITQ Sbjct: 125 AIDPNFGGCGRAITDEEGRYHFRTVRPGAYPWPNGVNDWRPAHIHFSIFGHGFAQRLITQ 184 Query: 182 MYFEGDPLIWKCPIVKTIPDEDAIRRLIAPLDMNATLPMDMLAYKFDIVLRGRRSTLFEN 241 MYFEGDP+IWKCPIV TIPD+ AI +LIAPLD T+PMD AYKFDIVLRGRRST+FEN Sbjct: 185 MYFEGDPMIWKCPIVGTIPDKAAIEQLIAPLDWGNTIPMDSRAYKFDIVLRGRRSTMFEN 244 Query: 242 RMEGN 246 R+EGN Sbjct: 245 RLEGN 249 Lambda K H 0.322 0.142 0.457 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 314 Number of extensions: 6 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 246 Length of database: 249 Length adjustment: 24 Effective length of query: 222 Effective length of database: 225 Effective search space: 49950 Effective search space used: 49950 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory