Align aminobutyraldehyde dehydrogenase (EC 1.2.1.19) (characterized)
to candidate WP_011425015.1 RHE_RS08800 aldehyde dehydrogenase family protein
Query= BRENDA::C6KEM4 (506 letters) >NCBI__GCF_000092045.1:WP_011425015.1 Length = 506 Score = 362 bits (930), Expect = e-104 Identities = 202/495 (40%), Positives = 289/495 (58%), Gaps = 9/495 (1%) Query: 12 LFIGGAWREPCLGRRLPVVNPATEATIGDIPAGTAEDVEIAVAAARDAFSRDGGRQWSRA 71 + I G W E + + P+ T+ PAG+A D E A+AAAR AF W R Sbjct: 20 MLIDGKW-EAGASHPIERIAPSHGVTVSRFPAGSATDAERAIAAARKAFDEG---PWPRM 75 Query: 72 PGAVRANFLRAIAAKIKDRKSELALLETLDSGKPLDEASGDMDDVAACFEYYADLAEALD 131 + R+ L A I R ELA L+ +++GKP+ + G++ + Y A LA L Sbjct: 76 TASERSAILLKAADLIAARAEELAFLDAIEAGKPITQVRGEIAGSVDIWRYAAALARDLH 135 Query: 132 GKQRSPISLPMENFKSYVLKEPIGVVGLITPWNYPLLMATWKVAPALAAGCTTILKPSEL 191 G+ + + + VL+E IGVV +ITPWN+P L+ K+ ALAAGCTT++KPSEL Sbjct: 136 GESYNTLG---DGTVGVVLREAIGVVSIITPWNFPFLIVGQKLPFALAAGCTTVVKPSEL 192 Query: 192 ASVSCLELGAICMEIGLPPGVLNIITGLGPEAGAPLSSHSHVDKVAFTGSTETGKRIMTS 251 S S L LG I + G+P GV+NI+TG GPE GA ++SH VD ++FTGST GK M + Sbjct: 193 TSGSTLVLGEILQQAGVPDGVVNIVTGTGPEVGAVMTSHPDVDMISFTGSTGVGKLTMKN 252 Query: 252 AAQMVKPVSLELGGKSPLIVFDDIGDIDKAVEWTMFGIFANAGQVCSATSRLLLHEKIAK 311 AAQ +K VSLELGGK+P IVF D D+D ++ +FG + NAG+ C+A SRL+LH+ IA Sbjct: 253 AAQTLKKVSLELGGKNPQIVFPD-ADLDAFIDAAVFGAYFNAGECCNAGSRLILHKSIAS 311 Query: 312 KFLDRLVAWAKNIKVSDPLEEGCRLGSVISEGQYEKIKKFISTARSEGATILYGGGRPQH 371 + R+ +K +KV DPL+ ++G++I+ EKI +++ ARS GA + + GG Sbjct: 312 DVVRRVAELSKGVKVGDPLDPQTQVGAIITPQHLEKISGYVAGARSNGARVTH-GGETLD 370 Query: 372 LRRGFFLEPTIITDVSTSMQIWQEEVFGPVICVKEFRTDSEAVELANDTHYGLAGAVISN 431 L G F+ PTI+ V+ M + +EEVFGPV+ V F T +EAV +AN YGL+ V S Sbjct: 371 LGMGQFMSPTILEAVTPDMAVAREEVFGPVLSVLTFETTAEAVRIANSIDYGLSAGVWSR 430 Query: 432 DQERCERISKALHSGIIWINCSQPCFVQAPWGGNKRSGFGRELGEWGLDNYLTVKQVTKY 491 D + C I +++ +G IW+N + P+GG K+SG GRELG +++Y K + + Sbjct: 431 DFDTCLTIGRSVRAGTIWMNTFMDGASELPFGGYKQSGLGRELGRHAVEDYTETKTLNMH 490 Query: 492 CSDEPWGWYQPPSKL 506 W KL Sbjct: 491 IGKRTNWWMPQTEKL 505 Lambda K H 0.318 0.136 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 622 Number of extensions: 34 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 506 Length of database: 506 Length adjustment: 34 Effective length of query: 472 Effective length of database: 472 Effective search space: 222784 Effective search space used: 222784 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory