Align 4-guanidinobutyraldehyde dehydrogenase (EC 1.2.1.54) (characterized)
to candidate WP_011425015.1 RHE_RS08800 aldehyde dehydrogenase family protein
Query= metacyc::MONOMER-11560 (497 letters) >NCBI__GCF_000092045.1:WP_011425015.1 Length = 506 Score = 348 bits (892), Expect = e-100 Identities = 192/472 (40%), Positives = 282/472 (59%), Gaps = 6/472 (1%) Query: 21 RAFINGEYTDAVSGETFECLSPVDGRFLAKVASCDLADANRAVENARATFNSGVWSQLAP 80 + I+G++ +A + E ++P G +++ + DA RA+ AR F+ G W ++ Sbjct: 19 KMLIDGKW-EAGASHPIERIAPSHGVTVSRFPAGSATDAERAIAAARKAFDEGPWPRMTA 77 Query: 81 AKRKAKLIRFADLLRKNVEELALLETLDMGKPIGDSSSIDIPGAAQAIHWTAEAIDKVYD 140 ++R A L++ ADL+ EELA L+ ++ GKPI +I G+ + A ++ Sbjct: 78 SERSAILLKAADLIAARAEELAFLDAIEAGKPITQVRG-EIAGSVDIWRYAAALARDLHG 136 Query: 141 EVAPTPHD-QLGLVTREPVGVVGAIVPWNFPLLMACWKLGPALATGNSVVLKPSEKSPLT 199 E T D +G+V RE +GVV I PWNFP L+ KL ALA G + V+KPSE + + Sbjct: 137 ESYNTLGDGTVGVVLREAIGVVSIITPWNFPFLIVGQKLPFALAAGCTTVVKPSELTSGS 196 Query: 200 AIRIAQLAIEAGIPAGVLNVLPGYGHTVGKALALHMDVDTLVFTGSTKIAKQLMVYAGES 259 + + ++ +AG+P GV+N++ G G VG + H DVD + FTGST + K M A ++ Sbjct: 197 TLVLGEILQQAGVPDGVVNIVTGTGPEVGAVMTSHPDVDMISFTGSTGVGKLTMKNAAQT 256 Query: 260 NMKRIWLEAGGKSPNIVFADAPDLQAAAEAAASAIAFNQGEVCTAGSRLLVERSIKDKFL 319 +K++ LE GGK+P IVF DA DL A +AA FN GE C AGSRL++ +SI + Sbjct: 257 -LKKVSLELGGKNPQIVFPDA-DLDAFIDAAVFGAYFNAGECCNAGSRLILHKSIASDVV 314 Query: 320 PMVVEALKGWKPGNPLDPQTTVGALVDTQQMNTVLSYIEAGHKDGAKLLAGGKRTLEETG 379 V E KG K G+PLDPQT VGA++ Q + + Y+ +GA++ GG+ TL+ Sbjct: 315 RRVAELSKGVKVGDPLDPQTQVGAIITPQHLEKISGYVAGARSNGARVTHGGE-TLDLGM 373 Query: 380 GTYVEPTIFDGVTNAMRIAQEEIFGPVLSVIAFDTAEEAVAIANDTPYGLAAGIWTSDIS 439 G ++ PTI + VT M +A+EE+FGPVLSV+ F+T EAV IAN YGL+AG+W+ D Sbjct: 374 GQFMSPTILEAVTPDMAVAREEVFGPVLSVLTFETTAEAVRIANSIDYGLSAGVWSRDFD 433 Query: 440 KAHKTARAVRAGSVWVNQYDGGDMTAPFGGFKQSGNGRDKSLHALEKYTELK 491 R+VRAG++W+N + G PFGG+KQSG GR+ HA+E YTE K Sbjct: 434 TCLTIGRSVRAGTIWMNTFMDGASELPFGGYKQSGLGRELGRHAVEDYTETK 485 Lambda K H 0.316 0.132 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 614 Number of extensions: 28 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 497 Length of database: 506 Length adjustment: 34 Effective length of query: 463 Effective length of database: 472 Effective search space: 218536 Effective search space used: 218536 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory