Align glutaryl-CoA dehydrogenase (ETF) (EC 1.3.8.6) (characterized)
to candidate WP_011427691.1 RHE_RS23165 isovaleryl-CoA dehydrogenase
Query= BRENDA::Q3JP94 (395 letters) >NCBI__GCF_000092045.1:WP_011427691.1 Length = 381 Score = 198 bits (503), Expect = 2e-55 Identities = 125/376 (33%), Positives = 192/376 (51%), Gaps = 2/376 (0%) Query: 13 LLDQQLADDERMVRDAAHAYAQGKLAPRVTEAFRHETTDAAIFREMGEIGLLGPTIPEQY 72 + D L + +RD +A ++AP E T ++ +MG +GL G T+ E++ Sbjct: 1 MFDFSLGETADAIRDTTARFAADRIAPLAAEIDESNTFPRQLWPQMGALGLHGITVEEEF 60 Query: 73 GGPGLDYVSYGLIAREVERVDSGYRSMMSVQSSLVMVPIFEFGSDAQKEKYLPKLATGEW 132 GG GL Y+ + + EV R + S+L + I +GS QK ++LPKL +GE Sbjct: 61 GGAGLGYLEHVVAMEEVSRASASVGLSYGAHSNLCVNQIRRWGSAEQKRRHLPKLISGEH 120 Query: 133 IGCFGLTEPNHGSDPGSMVTRARKVPGGYSLSGSKMWITNSPIADVFVVWAKLD-EDGRD 191 +G ++E GSD SM RA K Y L+G+K WITN+P ADV VV+AK D G Sbjct: 121 VGSLAMSEVGSGSDVVSMRLRAEKRGDRYILNGAKFWITNAPHADVLVVYAKSDPAAGPK 180 Query: 192 EIRGFILEKGCKGLSAPAIHGKVGLRASITGEIVLDEAFVPEENILPHV-KGLRGPFTCL 250 I FI+EK G S K+G+R S T E+V + VP E ++ +G++ + L Sbjct: 181 GISAFIIEKALPGFSVSKKLSKLGMRGSDTAELVFQDCEVPAEALMGREGEGVKILMSGL 240 Query: 251 NSARYGIAWGALGAAESCWHIARQYVLDRKQFGRPLAANQLIQKKLADMQTEITLGLQGV 310 + R +A G LG ++C + YV DRKQFG+P+ QL+Q K+ADM + V Sbjct: 241 DYERAVLAGGPLGIMQACLDVVLPYVRDRKQFGKPIGDFQLMQAKIADMYVALNSARAYV 300 Query: 311 LRLGRMKDEGTAAVEITSIMKRNSCGKALDIARLARDMLGGNGISDEFGVARHLVNLEVV 370 + R D G + + A+ ++ A LGG G + E+ V R L + ++ Sbjct: 301 YSVARACDAGRTTRTDAAAAILFASENAVKVSLEAIQALGGAGYTKEWPVERFLRDAKLY 360 Query: 371 NTYEGTHDIHALILGR 386 + GT++I ++GR Sbjct: 361 DIGAGTNEIRRYLIGR 376 Lambda K H 0.320 0.138 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 332 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 395 Length of database: 381 Length adjustment: 30 Effective length of query: 365 Effective length of database: 351 Effective search space: 128115 Effective search space used: 128115 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory